Translate to English Translate to Spanish Translate to French Translate to German Translate to Italian Translate to Russian Translate to Chinese Translate to Japanese

  

 

Planeta Criança



Poesia & Contos Infantis

 

 

 


MUNDO PERDIDO / Michael Crichton
MUNDO PERDIDO / Michael Crichton

 

 

Biblioteca Virtual do Poeta Sem Limites

 

 

MUNDO PERDIDO

 

        O final do século XX testemunhou um notável aumento do interesse científico pelo tema da extinção das espécies. E é na esteira desse debate que Michael Crichton lança seu Mundo perdido.

        Ian Malcolm, um matemático iconoclasta, juntamente com uma equipe de pesquisadores, curiosamente heterogênea e munida de sofisticado equipamento, resolvem voltar ao Parque dos Dinossauros numa ilha da Costa Rica. O mistério da extinção dos dinossauros, ocorrida há sessenta e cinco milhões de anos, ainda está insolúvel. Qual a causa do seu desaparecimento? Desvendar esse mistério permitirá saber se os seres humanos também estariam fadados à extinção.

        Com uma narrativa dinâmica e surpreendente, Michael Crichton nos conduz ao seu Mundo perdido, um mundo de terror onde o tempo parou e a luta pela sobrevivência é a única resposta possível.

 

       

         "O que realmente me interessa é saber se Deus teve alguma escolha na criação do mundo."

        ALBERT EINSTEIN

       

       "Extinção na Fronteira K-T"

        O final do século XX testemunhou um notável aumento do interesse científico pelo tema da extinção das espécies.

        Na realidade, não é um tema novo — o barão Georges Cuvier, em 1786, pouco depois da Revolução Americana, demonstrou que muitas espécies haviam sido extintas. Sendo assim, o fato da extinção das espécies já era aceito pelos cientistas quase três quartos de século antes de Darwin criar a teoria da evolução. E, depois de Darwin, as várias controvérsias a respeito da teoria nem sempre diziam respeito à extinção.

        Ao contrário, a extinção era considerada, de um modo geral, tão sem importância como um carro sem gasolina. A extinção das espécies era simplesmente uma prova da incapacidade de adaptação. Os vários modos dessa adaptação foram intensamente estudados e ardorosamente debatidos. Porém, o fato de que algumas espécies falhavam nesse processo não era considerado importante. O que se podia dizer a respeito? Entretanto, no começo da década de 1970, dois fatos contribuíram para enfocar o tema da extinção sob uma nova ótica.

        O primeiro foi o reconhecimento de que o seres humanos eram agora muito numerosos e estavam rapidamente alterando o planeta — eliminando habitats tradicionais, desmatando as florestas tropicais, poluindo o ar e a água, talvez até mesmo modificando o clima global. No processo, muitas espécies animais estavam sendo extintas. Alguns cientistas deram o alarme. O silêncio de outros era preocupante. Até que ponto ia a fragilidade do ecossistema da Terra? O comportamento da espécie humana a levaria finalmente à própria extinção?

        Ninguém tinha certeza. Uma vez que ninguém se dera ao trabalho de estudar a extinção de modo organizado, poucas eram as informações sobre os índices de extinção em outras eras geológicas. Então os cientistas começaram a estudar a extinção no passado, esperando encontrar respostas para a ansiedade com o presente.

        O segundo fato diz respeito a novos conhecimentos sobre a morte dos dinossauros. Há muito era sabido que todas as espécies de dinossauros foram extintas num tempo relativamente curto, no fim do período Cretáceo, aproximadamente sessenta e cinco milhões de anos atrás. O modo pelo qual ocorreu essa extinção foi, durante longo tempo, motivo de calorosos debates. Alguns paleontólogos acreditavam que fora catastroficamente rápido, outros achavam que a morte dos dinossauros fora mais gradual, processando-se num período de dez mil a dez milhões de anos — sem dúvida, nem um pouco rápido.

        Então, em 1980, o físico Luis Alvarez e três colaboradores descobriram concentrações do elemento irídio em rochas do fim do Cretáceo e começo da era terciária — a chamada fronteira K-T ( foi estabelecido que o Cretáceo seria indicado pela letra K para não confundir com o Cambriano e outros períodos geológicos). O irídio é raro na Terra, mas abundante em meteoros. A equipe de Alvarez argumentou que a presença de grande quantidade de irídio nas rochas da fronteira K-T sugeria que um meteorito gigante, com muitos quilômetros de diâmetro, havia colidido com a Terra naquela época. Sua teoria era de que a poeira e fragmentos de rochas que haviam escurecido o céu inibiram a fotossíntese, matando plantas e animais e terminando com o reino dos dinossauros.

        Esta teoria dramática capturou a imaginação da mídia e do público e deu início a uma controvérsia que durou muitos anos. Onde estava a cratera do meteoro? Vários locais foram propostos. No passado houve cinco períodos principais de extinção — teriam sido todos causados por meteoros? Haveria um ciclo de catástrofe de vinte e seis milhões de anos? O planeta estaria agora à espera de outro impacto devastador?

       

        Durante mais de uma década essas perguntas continuaram sem resposta. O debate seguiu cada vez mais intenso — até agosto de 1993, quando, num seminário semanal do Instituto Santa Fé, um matemático iconoclasta chamado Ian Malcolm anunciou que nenhuma dessas questões era importante e que o debate sobre o impacto de meteoro era “ uma especulação frívola e irrelevante” .

       

        — Considerem os números — disse Malcolm, inclinando-se no pódio, olhando diretamente para os seus ouvintes. — No nosso planeta existem atualmente cinqüenta milhões de espécies de plantas e animais. Achamos que é uma diversidade notável; contudo, não é nada comparado ao que existia antes. Estima-se que tenha havido cinqüenta bilhões de espécies neste planeta desde o começo da vida. Isso significa que para cada mil espécies que já existiram no planeta apenas uma permanece hoje. Desse modo, 99,9 por cento de todas as espécies que já viveram estão extintas. E a matança em massa é responsável apenas por cinco por cento desse total. A espantosa maioria das espécies morreu uma de cada vez.

        "A verdade", disse Malcolm, "é que a vida na Terra tem sido marcada por um índice contínuo e regular de extinção. De um modo geral, a duração média da vida de uma espécie era de quatro milhões de anos. Para os mamíferos era de um milhão de anos. Então as espécies desapareciam. Desse modo o verdadeiro padrão consistia no aparecimento de uma espécie, seu crescimento e sua morte num período de alguns milhões de anos. Podemos afirmar que a média da extinção foi de uma espécie por dia durante toda a história da vida no planeta.

        "Mas por quê?", perguntou ele. "O que leva ao crescimento e declínio das espécies da Terra num ciclo de quatro milhões de anos?

        "Uma resposta é que nós não fazemos idéia da intensa atividade do nosso planeta. Somente nos últimos cinqüenta mil anos — um piscar de olhos em geologia — as florestas tropicais foram drasticamente reduzidas; depois voltaram a expandir. As florestas tropicais não são uma característica extremamente antiga do nosso planeta. Na verdade, são relativamente novas. Há apenas dez mil anos, quando havia caçadores humanos no continente americano, uma camada de gelo estendia-se quase até onde hoje é a cidade de Nova York. Muitos animais foram extintos nessa época.

        "Assim, a maior parte da história da Terra mostra animais vivendo e morrendo num cenário extremamente ativo. Isso talvez explique 90 por cento das extinções. Se os oceanos secarem ou ficarem mais salgados, então é claro que o plâncton morrerá. Porém, animais complexos como os dinossauros insularam-se — literal e figuradamente — contra essas mudanças. Por que os animais complexos desaparecem? Por que não se ajustam? Fisicamente, parecem capazes de sobreviver. Não há nenhuma razão aparente para sua extinção. Contudo, eles desaparecem.

        "O que eu quero propor é que os animais complexos são extintos não devido a uma mudança na sua capacidade física de adaptação ao meio ambiente, mas por causa do seu comportamento. Minha suposição é que a moderna teoria do caos, ou dinâmica não-linear, nos dá pistas muito interessantes de como isso acontece.

        "Essa teoria afirma que o comportamento dos animais complexos pode mudar com grande rapidez e nem sempre para melhor. Afirma que o comportamento pode deixar de responder ao meio ambiente, levando ao declínio e à morte. Afirma que os animais podem parar de se adaptar. Foi isso o que aconteceu com os dinossauros? É essa a verdadeira causa do seu desaparecimento? Talvez jamais saibamos. Mas não é por acaso que os seres humanos estão tão interessados na extinção dos dinossauros. O declínio dos dinossauros permitiu o desenvolvimento e crescimento dos mamíferos — incluindo nós. E isso nos leva a indagar se o desaparecimento dos dinossauros vai se repetir, mais cedo ou mais tarde, com a espécie humana. Em nível mais profundo, a falha não estaria no destino — um meteoro caído do céu — mas no nosso comportamento. No momento não temos resposta."

        Depois ele sorriu.

        — Mas eu tenho algumas suposições — ele disse.

       

       "A vida no limite do caos"

        O Instituto Santa Fé foi instalado numa série de prédios da Canyon Road, onde antes era um convento e os seminários do instituto realizavam-se na sala onde era antes a capela. De pé no pódio, iluminado por um raio de sol, Ian Malcolm fez uma pausa dramática, antes de continuar a palestra.

        Malcolm tinha quarenta anos e era uma figura familiar no instituto. Foi um dos pioneiros da teoria do caos, mas teve sua carreira promissora prejudicada por um grave acidente durante uma viagem à Costa Rica. Na ocasião, Malcolm foi dado como morto em vários noticiários. Mais tarde, ele diria: "Eu senti muito por ter interrompido as comemorações em vários departamentos de matemática em todo o país, mas acontece que eu estava apenas levemente morto. Os cirurgiões fizeram maravilhas, como certamente serão os primeiros a afirmar. Assim, estou de volta — na minha iteração seguinte, podemos dizer."

        Vestido completamente de preto, apoiando-se numa bengala, Malcolm era a imagem da severidade. No instituto era conhecido por sua análise inconvencional e sua tendência para o pessimismo. Sua palestra em agosto, intitulada "A vida no limite do caos", era típica do seu pensamento. Nela, Malcolm apresentou sua análise da teoria do caos aplicada à evolução.

        Não podia ter exigido um grupo de ouvintes mais bem-informado. O Instituto Santa Fé foi criado em meados da década de 1980 por um grupo de cientistas interessados nas implicações da teoria do caos. Pertenciam a vários campos da ciência — física, economia, biologia, informática. O que tinham em comum era a crença de que a complexidade do mundo, escondida sob uma ordem que até então havia se esquivado à definição da ciência, seria revelada pela teoria do caos, agora conhecida como a teoria da complexidade. Segundo um cientista, a teoria da complexidade era "a ciência do século XXI".

        O instituto havia estudado o comportamento de uma grande variedade de sistemas complexos — empresas no mercado, neurônios no cérebro humano, cascatas de enzimas no interior de uma única célula, o comportamento grupai de pássaros migratórios —, sistemas tão complexos que não podiam ser estudados antes do advento do computador. Era uma pesquisa nova e os resultados foram surpreendentes.

        Não demorou para que os cientistas começassem a notar que os sistemas complexos apresentavam certos comportamentos em comum. Começaram a considerar esses comportamentos como característicos de todos os sistemas complexos. Compreenderam também que esses comportamentos não podiam ser explicados por meio da análise dos componentes dos sistemas. A abordagem científica tradicional do reducionismo — desmontar o relógio para ver como funciona — não levava a lugar algum nos sistemas complexos, porque o comportamento interessante parecia ter origem na interação espontânea dos componentes. O comportamento não era planejado nem dirigido, apenas acontecia. Esse comportamento foi por isso chamado de "auto-organizado".

        Entre os comportamentos auto-organizados — disse Ian  Malcolm —, dois são de especial interesse para o estudo da evolução. Um é a adaptação. Nós a vemos por toda a parte. As grandes empresas se adaptam ao mercado, as células do cérebro  adaptam-se para sinalizar o tráfego, o sistema imunológico se adapta à infecção, os animais se adaptam ao alimento que lhes é oferecido. Chegamos a pensar que a capacidade de adaptação é característica dos sistemas complexos — e pode ser uma das razões pelas quais a evolução parece levar a organismos mais complexos.

        Ele mudou de posição, transferindo o peso do corpo para a  bengala.

        — Contudo, o mais importante — prosseguiu — é o modo pelo qual os sistemas complexos parecem conseguir um equilíbrio entre a necessidade de ordem e o imperativo da mudança. Os sistemas complexos tendem a se posicionar num local a que chamamos de "o limite do caos". Imaginamos o limite do caos como um lugar onde há inovação suficiente para manter vibrante um sistema vivo, e bastante mobilidade para evitar que passe para a anarquia. É uma zona de conflito e de alterações importantes, onde o velho e o novo estão em luta constante. Encontrar o ponto de equilíbrio deve ser um processo bastante delicado — se um sistema vivo deriva para muito perto, arrisca-se a cair na incoerência e na dissolução, mas, se o sistema se afasta demais do limite, torna-se rígido, congelado, totalitário. As duas condições levam à extinção. Tanto o excesso quanto a escassez de mudança são destrutivos. Só no limite do caos os sistemas complexos podem se desenvolver. Fez uma pausa.

        — E, por implicação, a extinção é o resultado inevitável de uma ou outra dessas estratégias — muitas ou poucas mudanças.

        Os ouvintes balançavam a cabeça, concordando. Era um pensamento familiar para a maioria dos pesquisadores presentes. Na verdade, o conceito de limite do caos era praticamente um dogma no Instituto Santa Fé.

        — Infelizmente — continuou Malcolm — a lacuna entre esta síntese teórica e o fato da extinção é bastante extensa. Não temos meio de verificar se nosso pensamento está correto. Os registros fósseis podem nos dizer que um animal foi extinto numa determinada época, mas não por quê. As simulações no computador têm valor limitado. Também não podemos realizar pesquisas em organismos vivos. Sendo assim, somos obrigados a admitir que a extinção — não-verificável por meio de testes e não se prestando a experiências — talvez não seja de modo algum uma matéria científica. Isso pode explicar por que o assunto tem sido alvo da mais intensa controvérsia religiosa e política. Quero lembrar que não há nenhum debate religioso sobre o número de Avogadro, ou a constante de Planck, ou sobre as funções do pâncreas. Mas, quando se trata de extinção, a controvérsia continua há duzentos anos. E me pergunto como será resolvida se... Sim? O que é?

        No fundo da sala alguém ergueu a mão, acenando com impaciência. Malcolm franziu a testa, visivelmente aborrecido.

       

        Era tradição do instituto que as perguntas só fossem feitas no fim da apresentação. Era deselegante interromper a palestra.

        — Tem alguma pergunta? — perguntou Malcolm.

        Um homem de trinta e poucos anos levantou-se no fundo da sala.

        — Na verdade, uma observação — disse ele.

        Era um homem moreno e magro, com camisa e short caqui, movimentos e modos precisos. Malcolm o reconheceu. Era um paleontólogo de Berkeley, chamado Levine, que estava passando o verão no instituto. Malcolm jamais havia falado com ele, mas conhecia sua fama. A opinião geral era que Levine era o melhor paleobiólogo da sua geração, talvez o melhor do mundo. Mas não era muito querido no instituto devido a sua arrogância e pompo-sidade.

        — Eu concordo — disse Levine — que o registro fóssil não nos ajuda quando se trata da extinção. Especialmente se a sua tese consiste em afirmar que o comportamento é a causa da extinção — porque os ossos não nos dizem muita coisa sobre comportamento. Mas discordo quando diz que sua tese não pode ser testada. Na realidade, ela implica um resultado. Embora, talvez, o senhor não tenha ainda pensado nisso.

        A sala ficou em silêncio. Malcolm franziu a testa. O matemático eminente não estava acostumado a ouvir dizer que não havia examinado a fundo as próprias idéias.

        — Aonde quer chegar? — perguntou. Levine parecia indiferente à tensão na sala.

        —  Apenas a isto. Durante o Cretáceo, a espécie Dinosauria estava amplamente distribuída por todo o planeta. Temos encontrado seus restos em todos os continentes e em todas as zonas climáticas — até na Antártica. Muito bem, se sua extinção foi realmente resultado do seu comportamento e não conseqüência de uma catástrofe, uma doença ou uma mudança na vida das plantas, ou ainda qualquer das explicações de ampla escala que têm sido propostas, então parece pouco provável que todos tenham mudado o comportamento ao mesmo tempo, em todos os lugares. Isso significa que possivelmente existem ainda alguns desses animais vivos na terra. Por que não pode procurá-los?

        — Você pode — disse Malcolm, friamente — se isso o diverte. E se não tiver nada mais importante no que empregar seu tempo.

        — Não, não — disse Levine com urgência. — Falo sério. E se os dinossauros não foram extintos? Se existirem ainda? Em algum ponto isolado do planeta?

        — Está falando de um Mundo Perdido — observou Malcolm e várias cabeças na sala balançaram concordando. Os cientistas do instituto haviam criado uma terminologia para designar cenários evolucionários comuns. Falavam em Campo de Balas, Ruína do Jogador, o Jogo da Vida, o Mundo Perdido, a Rainha de Copas e o Ruído Negro. Eram meios bem-definidos de pensar na evolução. Mas eram todos...

        — Não — insistiu Levine. — Estou falando literalmente.

        — Então está redondamente enganado. — Malcolm abanou a mão, descartando o assunto. Deu as costas para o auditório e foi para o quadro-negro. — Muito bem, se considerarmos as implicações do limite do caos, podemos começar por perguntar qual é a menor unidade de vida? A maioria das definições contemporâneas da vida inclui a presença do DNA, mas existem dois exemplos que nos sugerem que essa definição seja por demais limitada. Se considerarmos os vírus e os chamados príons, concluiremos que, na realidade, a vida pode existir sem o DNA...

        No fundo da sala, Levine ficou imóvel por um momento; depois, com relutância, voltou a sentar e começou a tomar notas.

       

       A HIPÓTESE DO MUNDO PERDIDO

        Terminada a palestra, Malcolm atravessou claudicando o pátio aberto do instituto, logo depois do meio-dia. Ao lado dele caminhava Sarah Harding, uma jovem bióloga visitante, vinda da África. Malcolm a conhecia há vários anos, desde que fora convidado para ser o orientador externo da tese de doutorado de Sarah, na Universidade de Berkeley, Califórnia.

        Sob o sol do verão, formavam um par desigual. Malcolm, vestido de preto, ascético, ombros curvados para a frente, apoiado na bengala. Harding, compacta e musculosa, muito jovem e cheia de energia, com short e camiseta, o cabelo preto curto preso pelos óculos escuros no alto da cabeça. Seu estudo de campo eram os predadores da África, leões e hienas. Ia voltar para Nairóbi no dia seguinte.

        A amizade dos dois havia se solidificado desde o acidente sofrido por Malcolm. Harding estava de férias em Austin e ajudou a cuidar dele durante a convalescença, depois das várias operações a que fora submetido. Durante algum tempo parecia que estava nascendo um romance e que Malcolm, um solteirão empedernido, ia finalmente construir uma família. Mas então Harding voltou para a África e Malcolm foi para Santa Fé. Fosse qual fosse o tipo de relacionamento que tiveram antes, agora eram apenas bons amigos.

        Falavam sobre as questões que haviam surgido no final da palestra. Na opinião de Malcolm, todas as objeções foram previsíveis. Que a extinção em massa é importante, que os seres humanos devem sua existência à extinção do Cretáceo, que havia eliminado os dinossauros, permitindo o domínio dos mamíferos. Como um dos presentes dissera afetadamente,"O Cretáceo permitiu o surgimento de nossa consiência sensível neste planeta."

        A resposta de Malcolm fora imediata: "O que o faz pensar que os seres humanos são sensíveis e conscientes? Não há evidência disso. Os seres humanos jamais pensam por si mesmos, acham extremamente desconfortável. A maior parte dos membros da nossa espécie simplesmente repete o que ouve dizer — e fica perturbada quando é exposta a uma opinião diferente. O traço humano mais característico não é a consciência, mas o conformismo, e essa característica tem como resultado o conflito religioso. Os outros animais lutam por território e por alimento, mas os seres humanos, diferentes de todo o resto do reino animal, lutam por suas 'crenças'. Isso porque a crença dirige o comportamento, que tem grande importância evolutiva entre os seres humanos. Porém, numa época em que nosso comportamento pode nos levar à extinção, não vejo razão para supor um mínimo de consciência na nossa espécie. Somos conformistas autodestrutivos e obstinados. Qualquer outra visão da nossa espécie não passa de autocongra-tulação, ilusão. A pergunta seguinte."  ;

        Atravessando o pátio, ao lado dele, Sarah Harding disse, rindo:

        — Eles não gostaram muito disso.

        — Admito que é desanimador. Mas não se pode fazer nada. — Balançou a cabeça. — Esses são alguns dos melhores cientistas do país e mesmo assim... sem nenhuma idéia interessante. A propósito, qual é a história daquele homem que me interrompeu?

        — Richard Levine? — Ela riu. — Irritante, não é? Tem fama no mundo inteiro de ser um chato de galocha.

        Malcolm resmungou.

        — Eu que o diga.

        —  O problema é que ele é rico — disse Harding. — Já ouviu falar nas bonecas Becky?

        — Não. — Malcolm olhou rapidamente para ela.

        — Pois todas as meninas da América conhecem. É uma série, Becky, Sally e Francês, e muitas mais. São bonecas americanas. Levine é o herdeiro da empresa. Portanto, ele é um garoto rico e sabichão. Impetuoso, faz tudo o que quer.

        Malcolm balançou a cabeça, concordando.

       

        — Tem tempo para almoçar?    

        —  Claro, eu ficaria...                   

        — Dr. Malcolm! Espere! Por favor! Dr. Malcolm! Malcolm olhou para trás. Richard Levine, alto e magro, corria

        em direção a eles.

        — Oh, droga — disse Malcolm.

        — Dr. Malcolm — disse Levine. — Fiquei surpreso por ver que não levou mais a sério minha proposição.

        —  Como era possível? É absurda.

        — Sim, mas...

        — A senhora Harding e eu vamos almoçar — disse Malcolm, indicando Sarah com um gesto.

        — Sim, mas acho que devia reconsiderar — insistiu Levine. — Porque acredito que meu argumento é válido — é completamente possível, até mesmo provável que ainda existam dinossauros. Deve saber que há rumores persistentes sobre animais na Costa Rica, onde, se não me engano, você passou algum tempo.

        — Sim, e no caso da Costa Rica posso dizer que...

        —  Também no Congo — continuou Levine — Há anos os pigmeus vêm falando de um grande saurópode, talvez até mesmo um apatossauro na floresta densa da Birmânia. Também nas selvas de Irian Jaya supostamente existe um animal do tamanho de um rinoceronte, que pode ser um remanescente dos ceratopsianos...

        — Fantasia — disse Malcolm. — Pura fantasia. Nada jamais foi visto. Nenhuma fotografia. Nenhuma prova material.

        — Talvez não — disse Levine. — Mas a ausência de prova não é prova de ausência. Acredito que pode muito bem haver um local desses animais, sobreviventes dos tempos passados.

        Malcolm deu de ombros.                                                  

        —  Qualquer coisa é possível — disse ele.                         

        — Mas aponta para o fato de que a sobrevivência é possível — insistiu Levine. — Estou sempre recebendo telefonemas sobre animais na Costa Rica. Remanescentes, fragmentos.

        Depois de uma pausa, Malcolm perguntou:

        — Recentemente?

        —  Não, há algum tempo.                    

        —  Foi o que pensei.   

        — A última notícia foi há nove meses — disse Levine. — Eu estava na Sibéria examinando aquele filhote de mamute congelado e não consegui voltar a tempo. Mas disseram que era o mesmo tipo de lagarto, atípico e muito grande, encontrado morto na selva da Costa Rica.

        — E então? O que aconteceu com ele?

        — Os restos foram queimados.

        — Então não sobrou nada?                                                      

        — Nada.

        — Nenhuma foto? Nenhuma prova?

        — Aparentemente hão.

        — Então não passa de invenção — disse Malcolm.

        —  Talvez. Mas acredito que valha a pena organizar uma expedição para descobrir o que há a respeito desses supostos sobreviventes.

        Malcolm olhou severamente para ele.

        — Uma expedição? Para procurar um Mundo Perdido hipotético? Quem vai pagar?

        — Eu — disse Levine. — Já dei início aos planos preliminares.

        — Mas isso pode custar...

        — Não me importa quanto possa custar — disse Levine. — O fato é que é possível que haja sobreviventes. Já ocorreram em várias espécies de outros gêneros e pode haver também sobreviventes do período Cretáceo.

        — Fantasia — Malcolm disse outra vez, balançando a cabeça. Levine olhou para Malcolm.

        —  Dr. Malcolm, devo dizer que sua atitude me surpreende. Acaba de apresentar uma tese e eu estou oferecendo uma chance de prová-la. Eu tinha certeza de que saltaria imediatamente para não perder essa oportunidade.

        — Meu tempo de saltar já passou — disse Malcolm.

        — Mas, em vez de contra-argumentar, você...                    

        — Não estou interessado em dinossauros.

        — Mas todo o mundo está interessado em dinossauros.

        — Eu não. — Girou a bengala e começou a andar.

        —  A propósito — disse Levine —, o que estava fazendo na Costa Rica? Ouvi dizer que passou quase um ano lá.

        — Eu estava num leito de hospital. Passei meses na unidade de tratamento intensivo. Eu não podia sequer ser levado para um avião.

        — Sim — disse Levine. — Sei que sofreu um acidente. Mas, antes disso, o que estava fazendo lá? Não estava procurando dinossauros?

        Malcolm olhou para ele, entrecerrando os olhos para o sol e apoiou o peso do corpo na bengala.

        — Não — ele disse. — Não estava.

       

        Os três estavam sentados a uma pequena mesa pintada num canto do Café Guadalupe, no outro lado do rio. Sarah Harding tomava Corona na garrafa e observava os dois homens. Levine parecia satisfeito por estar com eles, como se o fato de estar ali fosse uma vitória. Malcolm parecia cansado, como um pai que passou tempo demais com um filho hiperativo.

        — Quer saber o que eu ouvi? — disse Levine. — Ouvi dizer que alguns anos atrás uma empresa chamada InGen criou geneticamente alguns dinossauros e os pôs numa ilha da Costa Rica. Mas alguma coisa saiu errada, muita gente foi morta e os dinossauros foram destruídos. Agora, ninguém fala a respeito por causa de alguma determinação legal. Acordos de guardar sigilo sobre a matéria, ou coisa parecida. E o governo da Costa Rica não quer prejudicar o turismo. Por isso ninguém diz nada, foi o que eu ouvi.

        Malcolm olhou para ele.

        —  E acredita nisso?

        —  A princípio não acreditei. Mas o caso é que continuei ouvindo a história. Os rumores flutuam por toda a parte. Supostamente, você, Alan Grant e um punhado de outros estavam lá.

        — Perguntou a Grant?

        — Perguntei, no ano passado, numa conferência em Pequim. Ele disse que é absurdo.

        Malcolm balançou a cabeça lentamente.

        —  É isso o que você diz? — Levine perguntou, tomando a cerveja. — Quero dizer, você conhece Grant, não conhece?

        — Não, nunca fomos apresentados. Levine o observava atentamente.

             — Então não é verdade?                   

        Malcolm suspirou.                           

         — Por acaso conhece o conceito de tecnomito? Foi criado por Geller, em Princeton. A tese básica é de que nós perdemos todos os velhos mitos, Orfeu e Eurídice, Perseu e Medusa. E preenchemos o vazio com o tecnomito moderno. Geller fez uma relação de uns doze mais ou menos. Um deles diz que um alienígena mora num hangar na Base da Força Aérea em Wright-Patterson. Outro diz que alguém inventou um carburador que permite percorrer duzentos e quarenta quilômetros com quatro litros de combustível, mas os fabricantes de automóveis compraram a patente e não permitem que seja usada. Há também a história de que os russos treinavam crianças em percepção extra-sensorial numa base secreta na Sibéria e que essas crianças podem matar pessoas em qualquer lugar do mundo só com a força do pensamento. A história de que em Nazca, Peru, há um aeroporto espacial alienígena. Que a CIA espalhou o vírus da AIDS para matar os homossexuais. Que Nikola Tesla descobriu uma fonte de energia incrível mas suas anotações foram perdidas. Que em Istambul existe uma gravura do século X mostrando a Terra vista do espaço. Que o Instituto de Pesquisas de Stanford encontrou um homem cujo corpo brilha no escuro. Dá para entender o que quero dizer?

        — Está dizendo que os dinossauros do InGen são um mito — disse Levine.

        —  É claro que são. Têm de ser. Acha possível criar um dinossauro geneticamente?

        — Todos os especialistas me dizem que não.

        —  Pois estão certos — disse Malcolm. Olhou para Harding, como para pedir confirmação. Ela não disse nada e continuou tomando cerveja.

        Na verdade, Harding sabia algo mais sobre esses rumores a respeito de dinossauros. Certa vez, depois de uma cirurgia, Malcolm estava delirando, murmurando incoerentemente ainda sob o efeito da anestesia e dos analgésicos. E ele parecia apavorado, debaten-do-se na cama, repetindo os nomes de vários tipos de dinossauros. Harding perguntou à enfermeira de que se tratava, e ela disse que isso acontecia sempre depois de cada operação. O pessoal do hospital supunha que fosse uma fantasia provocada pelos medicamentos — mas para Harding parecia que Malcolm estava revivendo uma experiência real apavorante. Essa idéia era reforçada pelo modo familiar com que Malcolm se referia aos dinossauros. Ele os chamava de "raptores", "comps" e "trikes". E parecia ter medo especialmente dos raptores.

        Mais tarde, quando ele já estava em casa, Sarah perguntou o que significavam aqueles delírios. Malcolm deu de ombros e fez uma piada sem graça: "Pelo menos eu não disse os nomes de outras mulheres, disse?" Depois fez um comentário a respeito de ser fanático por dinossauros quando criança e de como a doença nos faz regredir no tempo. Sua atitude era de indiferença forçada, como se não fosse importante. Harding teve a impressão exata de que ele estava sendo evasivo. Mas ela não pretendia insistir. Naquele tempo estava apaixonada por ele e o tratava com indulgência.

        Agora Malcolm olhava para ela interrogativamente, como perguntando se ia contradizê-lo. Harding limitou-se a erguer uma sobrancelha, com os olhos nos dele. Malcolm devia ter suas razões. Ela podia esperar que chegasse a hora da revelação.

        Levine se inclinou para Malcolm e disse:

        — Então a história da InGen é completamente falsa?

        — Completamente falsa — Malcolm respondeu, balançando a cabeça, muito sério. — Completamente falsa.

       

        Há três anos Malcolm vinha negando a especulação sobre o assunto. Agora estava ficando muito bom nisso. Seu cansaço já não era afetado, mas genuíno. Na verdade, ele foi um dos consultores da International Genetic Technologies em Paio Alto, no verão de 1989, e foi à Costa Rica a trabalho para a empresa, numa viagem que terminou desastrosamente. Depois da catástrofe, todos foram de opinião de que a história devia permanecer em segredo. A ÍnGen queria limitar suas despesas. O governo da Costa Rica queria preservar a fama de paraíso turístico. E os cientistas individualmente se comprometeram a guardar segredo e foram mais tarde regiamente recompensados para garantir seu silêncio. No caso de Malcolm, a empresa pagou dois anos de tratamento médico.

        As instalações da InGenn a ilha da Costa Rica foram destruídas. Já não havia nenhuma criatura viva na ilha. A empresa contratou o eminente professor de Stanford, George Baselton, biólogo e ensaísta cuja presença freqüente em programas de televisão o havia tornado uma autoridade popular em assuntos científicos. Baselton afirmou que havia visitado a ilha e negou categoricamente os rumores de que animais pré-históricos haviam existido no local. Sua frase zombeteira, "Ora, francamente, tigres dente-de-sabre!", contribuiu bastante para reforçar a negativa.

        Com o passar do tempo, o interesse diminuiu. A InGen há muito fora à falência. Os principais investidores da Europa e da Ásia arcaram com as perdas. Embora os bens físicos da empresa, os prédios e o equipamento de laboratório tenham sido leiloados, resolveram que a tecnologia de base por eles desenvolvida jamais seria vendida. Resumindo, o capítulo da InGen estava fechado.,

        Não havia nada mais para dizer.

       

        — Então não há nenhuma verdade na história — disse Levine, dando uma mordida no tamale de milho verde. — Para ser franco, Dr. Malcolm, agora sinto-me melhor.

        — Por quê? — quis saber Malcolm.

        —  Porque significa que os remanescentes que aparecem na Costa Rica devem ser reais. Dinossauros de verdade. Tenho um amigo de Ya-le na Costa Rica, biólogo de campo, e ele disse que já os viu. Acredito nele.

        Malcolm deu de ombros.

        — Eu duvido que qualquer animal apareça na Costa Rica.

        — É verdade que nenhum animal aparece na região há um ano. Mas se outros aparecerem, vou até lá. Enquanto isso, vou preparar uma expedição. Tenho pensado muito em como deve ser organizada. Acho que os veículos especiais podem ser fabricados em um ano. Já falei com o Dr. Thorne a respeito. Depois, vou formar uma equipe, talvez incluir a Dra. Harding ou outro naturalista tão conceituado quanto ela e alguns estudantes de graduação...

        Malcolm ouvia, balançando a cabeça.

        — Acha que estou perdendo tempo — disse Levine.

        — Sim, eu acho.

        — Mas suponha — apenas suponha — que os animais comecem a aparecer outra vez.

        — Nunca acontece.

        —  Mas suponha que eles apareçam — insistiu Levine. — Estaria interessado em me ajudar? A planejar uma expedição?

        Malcolm terminou seu jantar e empurrou o prato para o lado. Olhou para Levine.

        —  Sim — disse, finalmente. — Se os animais começarem a aparecer novamente, estarei interessado em ajudá-lo.

        — Ótimo — disse Levine. — E só o que eu queria saber.

       

        Na rua Guadalupe, sob o sol forte, Malcolm e Sarah caminharam para o velho Ford seda do cientista. Levine entrou numa Ferrari vermelha, acenou alegremente e partiu.

        — Acha que isso pode acontecer? — perguntou Sarah Harding. — Que esses animais podem começar a aparecer outra vez?

        — Não — respondeu Malcolm. — Tenho certeza de que nunca mais aparecerão.

        — Parece que é o que você deseja.

        Ele balançou a cabeça e entrou no carro com dificuldade, ajeitando a perna sob a direção. Harding sentou ao lado dele. Malcolm olhou rapidamente para ela e ligou o motor. Voltaram para o instituto.

       

        No dia seguinte Sarah voltou para a África. Nos dezoito meses seguintes, ficou mais ou menos a par dos progressos de Levine porque uma vez ou outra ele telefonava para perguntar alguma coisa sobre protocolo do trabalho de campo, pneus de veículos ou qual o melhor anestésico para animais selvagens. O Dr. Thorne, encarregado dos veículos, também telefonava ocasionalmente. Quase sempre parecia embaraçado.

        De Malcolm ela não teve nenhuma notícia, a não ser o cartão que ele mandou no seu aniversário e chegou com um mês de atraso. Malcolm escreveu: "Feliz aniversário. Fique feliz por não estar perto dele. O homem está me deixando louco."

        

PRIMEIRA  CONFIGURAÇÃO

 

Na região conservativa, distante do limite do caos, os elementos individuais aglutinam-se lentamente, sem nenhum padrão definido.

IAN MALCOLM

       

       FORMAS ABERRANTES

        À luz imprecisa do fim de tarde, o helicóptero sobrevoou a costa, acompanhando a linha onde a selva encontrava a praia. Há dez minutos haviam passado sobre a última aldeia de pescadores. Agora viam apenas a selva impenetrável da Costa Rica, pântanos, mangues e quilômetros e mais quilômetros de areia deserta. Ao lado do piloto, Marty Guitierrez olhava para baixo, para a linha da costa. Não havia nem estradas naquela região, pelo menos nenhuma que Guitierrez pudesse ver.

        Guitierrez era um americano tranqüilo de trinta e seis anos, usava barba, um biólogo de campo que foi há oito anos para a Costa Rica para estudar as espécies dos tucanos na floresta tropical e acabou ficando como consultor da Reserva Biológica de Carara, o parque nacional, ao norte. Ligou o microfone do rádio e perguntou para o piloto:                                                                           

        —  Quanto falta ainda?                                                             

        — Cinco minutos, senhor Guitierrez.      Guitierrez virou para trás e disse:         

        — Não vai demorar.

        Mas o homem alto, no banco de trás do helicóptero, não respondeu. Na verdade, nem pareceu ter ouvido. Continuou imóvel, com a mão no queixo, olhando pela janela com a testa franzida.

        Richard Levine estava de calça e jaqueta caqui desbotadas e chapéu de aba larga australiano enfiado na cabeça quase até os olhos. Um binóculo muito usado pendia do seu pescoço. Porém, apesar da aparência descuidada, seu ar era de atenção erudita. Sob os óculos com aros de metal, os traços eram fortes e a expressão, intensa e crítica.

        — Que lugar é este?

        — Chamam de Rojas.

        — Então estamos bem ao sul.

        — Estamos. A cerca de oitenta quilômetros da fronteira com o Panamá.                                                                       

        Levine olhou para a selva.

        — Não vejo nenhuma estrada. Como foi que encontraram essa coisa?

        —  Um casal que estava acampando — disse Guítierrez. — Vieram de barco, aportaram na praia.

        —  Quando foi isso?

        —  Ontem. Deram uma olhada na coisa e saíram correndo.

        Levine fez um gesto afirmativo. Com as pernas longas dobradas sobre o banco, as mãos debaixo do queixo, parecia um louva-a-deus. Esse era seu apelido no curso de graduação, em parte por causa da sua aparência, em parte por causa da sua tendência a  decepar com os dentes a cabeça de todos os que discordavam dele.  

        Guitierrez disse:                                                                   

        — Já esteve na Costa Rica antes?                                          

        — Não. É a primeira vez. — Depois, com um gesto irritado da mão, indicou que não estava disposto a falar sobre coisas sem  importância.                                                                             

        Guitierrez sorriu. Depois de tantos anos, Levine continuava o mesmo. Era ainda um dos mais brilhantes e mais irritantes homens de ciência. Os dois haviam estudado juntos no curso de graduação de Yale, até Levine abandonar o programa de doutorado para, se formar em zoologia comparada. Levine disse que não se interessava pela pesquisa de campo contemporânea que tanto atraía Guitierrez. Com seu desdém característico, certa vez descreveu o trabalho de Guitierrez como "coleta de cocô de papagaio pelo mundo afora".

        A verdade era que Levine — brilhante e exigente — sentia-se atraído pelo passado, pelo mundo que já não existia. E estudava esse mundo com intensidade obsessiva. Sua memória fotográfica era famosa, bem como a arrogância, a língua ferina e o prazer indisfarçável em apontar os erros dos colegas. Como disse um colega certa vez: "Levine jamais esquece uma controvérsia — e jamais nos deixa esquecer."

        Os pesquisadores de campo não gostavam de Levine e o sentimento era mútuo. No fundo ele era um detalhista, um catalogador da vida animal, e sentia-se feliz estudando as coleções dos museus, corrigindo as categorias das espécies, reconstruindo os esqueletos expostos. Não gostava da poeira e dos inconvenientes da vida no campo de estudo. Por sua vontade, Levine jamais sairia do museu. Mas era seu destino viver no maior período de descobertas da história da paleontologia. O número de espécies conhecidas de dinossauros tinha duplicado nos últimos vinte anos e novas espécies eram descritas, numa média de uma a cada sete semanas. Assim, a fama mundial de Levine o obrigava a viajar continuamente pelo mundo todo, examinando novas descobertas e dando sua opinião abalizada a pesquisadores que só a contragosto admitiam que precisavam dela.

        — De onde você veio? — perguntou Guitierrez.

        — Mongólia. Eu estava no deserto de Gobi, a três horas de Ulan Bator.

        — E mesmo? E o que há por lá?

        — John Roxton tem uma escavação. Ele descobriu um esqueleto incompleto e pensou que se tratasse de uma nova espécie de Velocirraptor. Queria a minha opinião.

        -E?

        Levine deu de ombros.

         - Na verdade, Roxton jamais conheceu coisa alguma de anatomia. E um hábil levantador de fundos, mas, quando descobre alguma coisa, não tem competência para continuar o trabalho.  — Disse isso a ele?

        — Por que não? E a verdade.

        — E o esqueleto?

        — O esqueleto não era de um raptor. Os ossos do metatarso são completamente diferentes, o púbis muito ventral, o ísquio sem um obturador adequado e os ossos longos leves demais. Quanto ao crânio... — Levine virou os olhos para o alto. — O palato muito espesso, as fenestras orbitais anteriores muito frontais, a carina distai muito pequena... e assim por diante. A saliência ungular quase inexistente. E isso. Não sei o que Roxton estava pensando. Suspeito que se trate de uma subespecie de Trodon, mas ainda não tenho certeza.   

        — Trodon ? — perguntou Guitierrez.  — Um pequeno carnívoro do Cretáceo, dois metros dos pés ao acetábulo. Na verdade, um terópodo bastante comum. E o que Roxton descobriu não é um exemplo especialmente interessante. Contudo, havia um detalhe curioso. O material incluía um artefato intergumental — uma marca de pele de dinossauro. Não é um achado raro. Até hoje já foram obtidas pelo menos uma dezena de boas impressões de pele, a maior parte entre os Hadrosauridal. Mas nenhuma igual a essa, uma vez que sem dúvida alguma essa pele de animal possui certas características incomuns nunca antes atribuídas aos dinossauros...

        — Senores — o piloto interrompeu. — Estamos chegando à baía de Juan Fernández.

        — E possível circular um pouco sobre ela antes de descer? — pediu Levine.

        Levine olhou pela janela, intensamente atento outra vez, a conversa esquecida. Estavam sobrevoando a selva, que se estendia por quilômetros e quilômetros nas encostas das colinas, até se perder de vista. O helicóptero virou para um lado para sobrevoar a praia.

        — Lá está — disse Guitierrez, apontando para fora da janela.

       

        A praia era um crescente limpo e branco, completamente deserta na luz do fim do dia. Para o sul viram a massa compacta e escura na areia. Lá de cima parecia uma rocha, ou talvez um monte de algas marinhas. Era informe, com mais ou menos um metro e meio de largura. Em volta dela havia uma porção de pegadas.

        — Quem esteve aqui? — perguntou Levine, com um suspiro.

        — O pessoal do Serviço de Saúde Pública esteve na praia esta manhã.

        — Fizeram alguma coisa? Tocaram no animal ou alteraram sua posição?

        — Não sei dizer — respondeu Guitierrez.

        — O Serviço de Saúde Pública — disse Levine, balançando a cabeça. — O que eles sabem? Marty, não devia ter deixado que chegassem perto.

        —  Ei, eu não governo o país. Fiz o melhor possível. Eles queriam destruir tudo antes mesmo de você chegar. Pelo menos consegui manter o animal intacto até agora. Mas não sei até quando vão esperar.

        — Então é melhor começar o trabalho — disse Levine. Apertou o botão do microfone. — Por que estamos ainda circulando? Estamos perdendo a luz do dia. Desça na praia agora. Quero ver aquela coisa em primeira mão.

        Richard Levine correu pela areia na direção da forma escura, com o binóculo balançando sobre o peito. Mesmo à distância ele sentia o cheiro da deterioração. E já começava a anotar suas primeiras impressões. A carcaça estava semi-enterrada na areia, cercada por uma espessa nuvem de moscas. A pele estava entumescida, cheia de gás, o que dificultava a identificação.

        Levine parou a poucos metros da criatura e tirou a câmera da mochila. Imediatamente o piloto do helicóptero se aproximou e abaixou a mão dele.

        — No permitido.

        — O quê?

        — Desculpe, senor. Não é permitido tirar fotos.

        — Por que diabo não é permitido? — perguntou Levine. Virou para Guitierrez que corria na praia na direção deles. — Marty, por que não fotografias? Isto pode ser uma importante...

        — Nada de fotografias — disse o piloto, tirando a câmera das mãos de Levine.

        — Marty, isto é coisa de louco.

        — Vá em frente e faça seu exame — disse Guitierrez, e começou a falar em espanhol com o piloto, que respondia nervoso e autoritário, gesticulando agitado.

        Levine olhou para os dois por um momento e virou para o animal morto. Para o diabo com tudo aquilo, pensou. Eles podem ficar discutindo pelo resto da noite. Correu para a frente, respirando pela boca. O cheiro era muito mais forte de perto. Embora a carcaça fosse grande, ele notou a ausência de pássaros, ratos ou outros necrófagos. Só havia moscas — um enxame tão denso que cobria toda a pele, obscurecendo os contornos do animal.

        Mesmo assim, via-se que se tratava de uma criatura grande, mais ou menos do tamanho de uma vaca ou um cavalo, antes de começar a inchar. A pele estava rachada pelo calor do sol e começava a descascar, expondo a camada subdérmica, amarela e pegajosa.

        Nossa, como fedia! Levine fez uma careta. Com esforço tentou voltar toda a atenção para o animal morto.

        Podia ter o tamanho de uma vaca, mas não era um mamífero. Não tinha pêlos. A cor original aparentemente era verde, com uma sugestão de listras mais escuras. A superfície epidérmica era coberta por tubérculos poligonais de vários tamanhos, num padrão que lembrava a pele de um lagarto. A textura variava nas diferentes partes, os tubérculos maiores e menos distintos na parte inferior da barriga. Havia grandes dobras de pele no pescoço, nós ombros e nas juntas das ancas — mais uma vez lembrando um lagarto.

        Mas a carcaça era grande. Levine estimou que o animal devia pesar originalmente cerca de cem ou cento e dez quilos. Nenhum lagarto crescia tanto, em nenhuma parte do mundo, exceto os dragões komodo da Indonésia. Os Varanus komodoensis eram lagartos monitores com dois metros e setenta de comprimento, carnívoros do tamanho de crocodilos que devoravam cabras e porcos, e às vezes seres humanos. Mas não havia lagartos monitores em nenhum lugar do Novo Mundo. É claro que este podia ser um espécime dos Iguanidae. Os iguanas podiam ser encontrados em toda a América do Sul e os iguanas marinhos eram bem grandes. Mesmo assim, o tamanho desse animal era um recorde.

        Levine caminhou lentamente em volta da carcaça, na direção da frente do animal. Não, pensou ele, não é um lagarto. A carcaça está de lado, com as costelas do lado esquerdo viradas para cima. Quase a metade estava enterrada na areia. A fileira de protuberâncias que marcavam o progresso da espinha dorsal estava poucos centímetros acima da areia. O pescoço longo, curvado, a cabeça escondida sob o corpo, como a cabeça de um pato sob as penas. Levine viu uma pata dianteira, que parecia pequena e fraca. O apêndice distai estava enterrado na areia. Pretendia cavar e examinar, mas precisava tirar algumas fotos antes de alterar a posição do espécime in situ.

        Na verdade, quanto mais Levine examinava a carcaça, mais se convencia de que precisava proceder com cuidado. Porque uma coisa estava clara — era um animal muito raro e possivelmente desconhecido. Levine sentia um misto de entusiasmo e cautela. Se aquela descoberta fosse tão importante quanto ele começava a pensar, então era essencial documentar adequadamente.

        Na praia Guitierrez continuava gritando com o piloto, que continuava a balançar a cabeça teimosamente. A burocracia da república das bananas, pensou Levine. Porque não podia fotografar? Não ia fazer mal nenhum. E era de vital importância documentar o estado de mudança da criatura.

        Ouviu um zumbido e, ao olhar para cima, avistou um segundo helicóptero sobrevoando a baía, a sombra escura deslizando na areia. Era branco como uma ambulância, com letras vermelhas num dos lados. Estava contra a luz do sol poente, e não conseguiu ler.

        Levine voltou para a carcaça, notando que a perna traseira do animal era forte e musculosa, muito diferente da perna dianteira. Sugeria que a criatura andava de pé, apoiada nas fortes pernas traseiras. Muitos lagartos andam assim, é claro, mas nenhum do tamanho daquele. Na verdade, quanto mais Levine observava os vários aspectos da carcaça, mais se convencia de que não era um lagarto.

        Procurou apressar seu exame do animal porque a luz do sol estava cada vez mais fraca e ele tinha muito que fazer ainda. No estudo de qualquer espécime deviam ser feitas duas perguntas igualmente importantes. Primeira, que animal era aquele? Segunda, qual a causa da sua morte?

        Examinando a anca do animal, viu uma estreita laceração na pele, sem dúvida devida à expansão dos gases subcutâneos. Porém, quando olhou com maior atenção, verificou que era um corte profundo que se estendia por toda a extensão do fêmur e da tíbia, expondo o músculo vermelho e o osso sob ele. Levine se aproximou, ignorando o cheiro e os vermes brancos que se moviam nos tecidos expostos da laceração porque compreendeu que...

        — Eu sinto muito — disse Guitierrez, aproximando-se dele. — Mas o piloto se recusa a dar permissão.

        O piloto parou ao lado de Guitierrez, observando nervosamen-te os dois homens.

        — Marty — disse Levine. — Eu realmente preciso tirar algumas fotos.     

        — Infelizmente, não é possível. — Guitierrez deu de ombros.

        — É importante, Marty.                                        

        — Sinto, mas já fiz o possível.

        Adiante, na praia, o helicóptero branco aterrissou na areia e o ruído do motor diminuiu. Homens uniformizados começaram a desembarcar.

        — Marty, o que você acha que é este animal?

        — Bem, só posso dar um palpite — respondeu Guitierrez. — A julgar pelas dimensões gerais, eu diria que é um iguana nunca antes identificado. É extremamente volumoso, é claro, e evidentemente não-nativo da Costa Rica. Meu palpite é que veio das ilhas Galápagos, ou da...

        — Não, Marty — disse Levine. — Não é um iguana.

        — Antes que você diga mais alguma coisa — Guitierrez olhou rapidamente para o piloto —, precisa saber que várias espécies desconhecidas de lagartos têm aparecido nesta área. Ninguém sabe ao certo por quê. Talvez por causa de desmatamentos na floresta tropical, ou outra coisa qualquer. Mas estão aparecendo espécies novas. Há alguns anos têm aparecido espécies não-identificadas de...

        — Marty. Não é um maldito lagarto.      Guitierrez piscou os olhos.

              — O que está dizendo? É claro que é um lagarto.

        — Acho que não é — insistiu Levine.

        — Provavelmente você está se deixando enganar pelo tamanho. O fato é que aqui, na Costa Rica, ocasionalmente encontramos essas formas aberrantes...

        — Marty — Levine interrompeu. — Eu nunca me deixo enganar.

        — Bem, é claro, eu não quis dizer isso...

        — Estou dizendo que não é um lagarto.

        — Desculpe — Guitierrez balançou a cabeça. — Mas não posso concordar com você.

        Os homens, reunidos ao lado do helicóptero, estavam pondo máscaras cirúrgicas.

        — Não estou pedindo que concorde comigo — disse Levine, voltando para a carcaça. — O diagnóstico pode ser estabelecido facilmente, tudo o que temos a fazer é escavar para tirar da areia a cabeça, ou um dos membros, por exemplo, este aqui, que eu acredito...

        Não terminou a frase e se inclinou para a frente. Examinou a parte anterior da coxa do animal.                       

        —  O que é? — perguntou Guitierrez.               

        —  Dê-me seu canivete.                            

        —  Para quê?                                                              

        — Apenas me dê o canivete.

        Guitierrez tirou o canivete do bolso e o entregou com o cabo voltado para Levine, que olhou atentamente para a carcaça.

        — Acho que vai achar isto interessante.

        — O quê?

        — Acompanhando a linha posterior da derme há um...

        De repente ouviram gritos na praia e viram os homens do helicóptero correndo para eles. Carregavam tanques de metal nas costas e gritavam em espanhol.

        — O que estão dizendo? — perguntou Levine, franzindo a testa. Guitierrez suspirou.

        — Estão mandando que nos afastemos.

        — Diga que estamos ocupados. — Levine se inclinou outra vez para o animal.

        Mas os gritos continuaram. De repente ouviram algo como um rugido furioso, e, erguendo os olhos, Levine viu os lança-chamas ligados lançando enormes jatos de fogo à luz do fim do dia. Ele deu a volta na carcaça e correu para os homens, gritando:

        — Não! Não!

        Mas ninguém deu atenção. Ele gritou.

        — Não, isto é um precioso...

        O primeiro homem uniformizado segurou Levine e o jogou violentamente na areia.

        — Que diabo estão fazendo? — Levine berrou, levantando-se. Mas, antes de acabar de falar, viu que era tarde demais. As

        primeiras chamas tinham alcançado a carcaça, escurecendo a pele, acendendo as bolas de metano com um puft azulado. A fumaça espessa começou a subir para o céu.

        — Parem! Parem! — Levine virou para Guitierrez. — Mande parar com isso!

        Mas Guitierrez estava imóvel, olhando para a carcaça. Consumido pelas chamas, o torso se abriu e a gordura saiu em jatos. Então, a pele toda foi queimada, as costelas negras e grossas apareceram, o torso inteiro girou, e de repente o pescoço do animal se ergueu, no meio das chamas, movendo-se à medida que a pele se contraía. E no interior do fogo Levine viu um focinho longo e pontudo com fileiras de dentes agudos e predadores, órbitas vazias, tudo queimando, como um dragão medieval subindo ao céu em chamas.

       

       SAN JOSÉ

        Sentado no bar do aeroporto, Levine tomava vagarosamente sua cerveja, esperando o avião que o levaria de volta aos Estados Unidos. Guitierrez, na frente dele no outro lado da pequena mesa, não parecia disposto a conversar. Há alguns minutos os dois guardavam um silêncio um tanto embaraçoso. Guitierrez olhou para a mochila de Levine no chão, a seus pés. Era de Gore-Tex verde-escuro, feita por encomenda, com bolsos extras no lado de fora para todo o material eletrônico.

        — Uma bela mochila — ele disse. — Onde a comprou? Parece uma mala de Thorne.

        — É uma mala de Thorne. — Levine tomou um gole de cerveja.

        — Bonita — repetiu Guitierrez, olhando para a mochila. — O que você tem aí na primeira bolsa, um telefone via satélite? Nossa, não sei o que mais vão inventar. Muito legal. Deve ter custado uma...

        — Marty — disse Levine, impaciente. — Pare com essa conversa mole. Vai me contar ou não?

        — Contar o quê?

        — Quero saber que diabo está acontecendo aqui.

        —  Richard, escute, eu sinto muito se você...                   

        — Não — interrompeu Levine. — Aquele espécime lá na praia era muito importante, Marty, e foi destruído. Não compreendo como você permitiu que isso acontecesse.

        Guitierrez suspirou. Olhou para os turistas na outra mesa e disse:

        — Mas isto tem de ser confidencial, está bem?

        —  Tudo bem.  

         — Há um grande problema aqui.

        —  Que problema?

        — Têm aparecido... bem... formas aberrantes na costa, uma vez ou outra. Há anos isso vem acontecendo.

        — Formas aberrantes? — repetiu Levine, balançando a cabeça, incrédulo.

        —  Esse é o termo oficial para esses espécimes — explicou Guitierrez. — Ninguém no governo quer ser mais preciso. Começou mais ou menos há cinco anos. Alguns animais foram descobertos nas montanhas, perto de uma remota estação agrícola que cultivava variedades experimentais de feijão-soja.

             — Feijão-soja — repetiu Levine.

             Guitierrez fez que sim com a cabeça.

        —  Aparentemente esses animais são atraídos por feijões e certas relvas. A suposição é de que precisam muito do aminoácido lisina na sua dieta. Porém ninguém tem certeza. Talvez apenas gostem de certos vegetais...

        — Marty — disse Levine. — Não me importa se eles gostam de cerveja e batatas fritas. A única coisa importante é saber de onde vêm.

        — Ninguém sabe.

        Levine ficou calado por um momento.

        — O que aconteceu com esses animais?

        — Foram destruídos. E, pelo que eu sei, nenhum outro apareceu durante anos. Mas agora parece que está recomeçando. No ano passado encontramos os restos de quatro animais, incluindo o que você viu hoje.

        — E o que foi feito?

        — As... formas aberrantes sempre são destruídas. Exatamente como você viu. Desde o começo o governo tem feito o possível para garantir que ninguém fique sabendo. Alguns anos atrás, alguns jornais americanos começaram a dizer que havia alguma coisa estranha numa das ilhas, a Islã Nublar. Menendez convidou um grupo de jornalistas para uma visita especial à ilha — e mandou levá-los de helicóptero a outra ilha. Eles nem perceberam a diferença. Coisas desse tipo. Quero dizer, o governo está encarando o problema com muita seriedade.

        —  Porquê?                                              

        —  Estão preocupados.                       

        — Preocupados? Por que ficar preocupado com... Guitierrez levantou a mão, mudou de posição na cadeira,

        aproximando-se mais de Levine.    

        — Doença, Levine.

        — Doença?

        — Isso mesmo. A Costa Rica tem um dos melhores sistemas de assistência à saúde do mundo — disse Guitierrez. — Os epidemiologistas estão procurando a origem de um tipo estranho de encefalite, cujo número de casos vêm aumentando, especialmente na costa.

        — Encefalite? De qual origem? Viral? Guitierrez balançou a cabeça.

        — Não foi encontrado nenhum agente causador da doença.

        — Marty...

        — É como estou dizendo, Richard. Ninguém sabe. Não é um vírus porque não há aumento da titulação de anticorpos e nenhuma mudança nos diferenciais dos glóbulos brancos. Não é uma bactéria porque não foi possível nenhuma cultura. E um mistério. Tudo o que os epidemiologistas sabem é que parece afetar especialmente os habitantes da zona rural, pessoas que convivem com animais. E é uma encefalite verdadeira — dores de cabeça lancinantes, confusão mental, febre, delírio...

        — Mortalidade?

        —  Até agora parece autolimitada, dura mais ou menos três semanas. Mas mesmo assim o governo está preocupado. O país depende do turismo, Richard. Ninguém quer falar sobre doenças desconhecidas.

        —  Então eles pensam que a encefalite está relacionada às formas aberrantes?

        Guitierrez deu de ombros.

        — Os lagartos transportam certa variedade de doenças virais. Constituem um vetor conhecido. Portanto, a conexão não é de todo sem propósito.

        — Mas você disse que não é uma doença viral.

        — Seja o que for. Eles pensam que há uma relação.

        — Mais uma razão para descobrir de onde vêm esses lagartos

        — observou Levine. — Certamente eles devem ter procurado...

        —  Procurado? — Guitierrez riu. — É claro que procuraram. Revistaram cada centímetro do país, vezes sem conta. Organizaram dezenas de grupos de busca — eu mesmo conduzi alguns. Fizeram reconhecimento aéreo. Sobrevoaram a selva. Sobrevoaram as ilhas distantes da costa. Só isso já constitui um grande trabalho. Como sabe, há muitas ilhas, especialmente na costa oeste. Diabo, eles até deram busca nas ilhas particulares.

        — Existem ilhas particulares? — perguntou Levine.

        —  Algumas. Três ou quatro. Como a Islã Nublar... uma empresa americana, a InGen, teve um leasing durante anos.

        — Mas você disse que essa ilha foi revistada...

        — Minuciosamente. Não encontraram nada.

        — Eas outras?

        — Bem, deixe ver. — Guitierrez começou a contar nos dedos.

        — Há a Islã Talamanca, na costa leste, onde fica o Club Med. A Sorna, na costa oeste, arrendada por uma empresa alemã de mineração. E a Morazan, ao norte, propriedade de uma família rica da Costa Rica. Pode haver outras que não lembro no momento.

        —  E o que eles encontraram?

        — Nada — disse Guitierrez. — Não encontraram coisa alguma. Assim, supõe-se que os animais venham de algum ponto remoto da selva. E por isso não conseguimos ainda encontrar.

        Levine resmungou.

        — Nesse caso, só com muita sorte.

        —  Eu sei. A floresta tropical é o ambiente perfeito para se esconder. Um grupo de busca pode passar a poucos metros de um animal sem vê-lo. Nem os sensores remotos da mais avançada tecnologia ajudam muito porque precisam penetrar várias camadas

        — nuvens, copas das árvores, flora rasteira. É quase praticamente impenetrável. Qualquer coisa pode se esconder na floresta tropical. Seja como for — continuou ele — o governo está frustrado. E é claro que não é o único interessado no caso.

        Levine ergueu os olhos rapidamente.

               -Oh?   

          —  Sim. Por algum motivo, parece que é muito grande o interesse por esses animais.

        — Que tipo de interesse? — Levine procurou parecer o mais calmo possível.

        — No outono passado, o governo concedeu permissão a um grupo de botânicos da Berkeley para fazer um reconhecimento aéreo das copas das árvores da selva no planalto central. Estavam trabalhando há um mês quando surgiu uma questão sobre o pagamento do combustível do avião, ou coisa parecida. Seja como for, um burocrata de San José telefonou para Berkeley reclamando. E Berkeley disse que não sabia nada sobre o tal grupo de estudo. Nesse ínterim, o grupo fugiu do país.

        — Então, ninguém sabe quem eles são?

        — Ninguém. Então, no último inverno, dois geólogos suíços apareceram para coletar amostras nas ilhas ao longo da costa, segundo eles como parte de um estudo das atividades vulcânicas na América Central. As ilhas ao largo da costa são todas vulcânicas e a maioria com vulcões relativamente ativos; portanto, parecia uma requisição razoável. Mas no fim os "geólogos" trabalhavam para uma empresa americana de genética chamada Biosyn e estavam procurando, bem... animais grandes nas ilhas.

        — Por que uma empresa de biotecnologia estaria interessada? — perguntou Levine. — Não faz sentido.

        — Talvez não para você e para mim, mas a Biosyn não tem boa fama. O chefe de pesquisa é um cara chamado Lewis Dodgson.

        — Oh, sim — disse Levine — Eu sei. O cara que fez aquele teste com vacina anti-rábica no Chile há alguns anos. O teste em que expunham os agricultores à raiva sem dizer o que estavam fazendo.

        — Esse mesmo. Ele também começou um teste de mercado de uma batata criada pela engenharia genética, nos supermercados, sem dizer a ninguém que era um produto alterado. Provocou diarréia nas crianças, algumas foram parar no hospital. Depois disso, a empresa teve de contratar George Baselton para consertar Nua imagem.

        — Parece que todo o mundo contrata Baselton — disse Levine. Guitierrez deu de ombros.

        —  Hoje em dia, os professores universitários de grande nome dão consultorias. Faz parte do negócio. E Baselton é catedrático de biologia. A companhia precisava dele para limpar a sujeira porque Dodgson tinha o hábito de violar a lei. Dodgson tem gente do mundo inteiro na folha de pagamentos. Roubam as pesquisas de outras empresas, fazem de tudo. Dizem que a Biosyn é a única empresa de engenharia genética com mais advogados do que cientistas.

        — E por que estavam interessados na Costa Rica? Guitierrez deu de ombros outra vez.

        —  Eu não sei, mas toda a atitude para com a pesquisa está mudada, Richard. Isso é bastante evidente aqui. A Costa Rica tem uma das ecologias mais ricas do mundo. Meio milhão de espécies em doze hábitats ambientais diferentes. Cinco por cento de todas as espécies do planeta estão representadas aqui. Este país tem sido durante anos um centro de pesquisa biológica e, posso garantir, as coisas estão mudando. Nos velhos tempos, as pessoas que vinham para cá eram cientistas dedicados que queriam aprender tudo, só por amor ao conhecimento e ao estudo — macacos-gritadores, vespas polistinas, plantas sombrilla. Pessoas que tinham escolhido seus campos de estudo porque gostavam do que faziam. Certamente não iam enriquecer com isso. Mas agora tudo na biosfera tem valor potencial. Ninguém sabe de onde vai sair o próximo medicamento, e por isso as empresas farmacêuticas criam todo o tipo de fundo de pesquisa. Talvez o ovo de um pássaro tenha proteínas capazes de inibir a coagulação do sangue. Talvez a superfície cerosa de uma samambaia contenha um analgésico. A atitude para com a pesquisa está mudando. As pessoas já não estudam o mundo natural, mas estão fazendo um trabalho de extração. E uma mentalidade de saqueador. Qualquer coisa nova ou desconhecida automaticamente é interessante porque pode ter algum valor. Pode valer uma fortuna.

        Guitierrez terminou a cerveja.

        — O mundo — disse ele — está de cabeça para baixo. E o fato é que muita gente quer saber o que representam esses animais aberrantes, e de onde vêm.

        O alto-falante anunciou o vôo de Levine. Os dois levantaram da mesa e Guitierrez disse:       

        — Vai guardar segredo? Quero dizer, de tudo que viu hoje?

        — Para ser franco — respondeu Levine —, eu não sei o que vi hoje. Podia ser qualquer coisa.                            

        Guitierrez sorriu.

        — Boa viagem, Richard.

        — Cuide-se, Marty.

                                                    

       A PARTIDA

        Com a mochila nas costas, Levine dirigiu-se para a sala de embarque. Voltou-se para acenar um adeus, mas Guitierrez já caminhava para a saída, com o braço levantado para chamar o táxi. Levine deu de ombros e continuou seu caminho.

        Logo adiante ficava o balcão de controle de passaportes, com uma fila na frente. Levine tinha reservado passagem no vôo noturno para San Francisco com uma longa escala na Cidade do México. A fila não estava muito longa. Provavelmente tinha tempo de telefonar para o escritório e avisar à sua secretária Linda a hora do vôo. Talvez, pensou, devesse também ligar para Malcolm. Olhou em volta e viu a fileira de telefones com a indicação ICT Teléfonos International, na parede da direita, mas eram poucos e estavam todos ocupados. Era melhor usar o telefone-satélite, pensou, tirando a mochila dos ombros, e talvez fosse melhor...

        Levine parou, pensando.

        Olhou outra vez para a parede.

        Quatro pessoas estavam usando os telefones. A primeira era uma mulher loura de short e top, balançando num braço uma criança queimada de sol enquanto falava. O segundo era um homem de barba com uma jaqueta safári, que olhava constantemente para o Rolex que tinha no pulso. A terceira era uma mulher grisalha, falando espanhol, enquanto os dois filhos adultos, ao seu lado, balançavam enfaticamente as cabeças confirmando o que ela dizia.

        A última pessoa nos telefones era o piloto do helicóptero. Não estava com o paletó do uniforme, mas com uma camisa de mangas curtas e gravata. Estava virado para a parede com os ombros curvados para a frente.

        Levine aproximou-se dele e ouviu que o piloto falava inglês. Levine pôs a mochila no chão e, enquanto ouvia, fingiu que estava ajustando as tiras. O piloto continuava de costas para ele.

        Levine ouviu o homem dizer: "Não, não, professor. Não é isso. Não." Uma pausa e ele disse: "Não, eu estou dizendo que não, desculpe, professor Baselton, mas não sabemos. É uma ilha, mas qual delas... Precisamos esperar mais informações. Não, ele vai partir esta noite. Não, acho que ele não sabe de nada e não tirou nenhuma foto. Não. Eu compreendo. Adiós."

        Levine abaixou a cabeça quando o piloto passou apressado na direção do balcão da LACSA, na outra extremidade do aeroporto.

        Que diabo é isso?, pensou Levine.

         É uma ilha, mas qual delas...

        Como sabiam que era uma ilha? O próprio Levine não tinha certeza. E há algum tempo vinha estudando a fundo esses achados, dia e noite, tentando encaixar todas as partes. De onde os animais tinham vindo? Por que aquilo estava acontecendo?

        Levine foi para um canto onde não podia ser visto e tirou da mochila o pequeno telefone-satélite. Digitou rapidamente um número de telefone em San Francisco.

        A ligação foi rápida, clicando quando entrou em contato com o satélite. O telefone no outro lado começou a tocar. Depois um bip e uma voz eletrônica disse: "Por favor, digite seu código de acesso."

        Levine digitou os seis números.

        Outro bip. A voz eletrônica disse: "Deixe sua mensagem."

        — Estou telefonando — disse Levine — para dar o resultado da viagem. Único espécime, não em boa forma. Localização: BB-17 no seu mapa. Isso fica bem ao sul, o que combina com todas as nossas hipóteses. Não consegui uma identificação exata antes de queimarem o espécime. Mas acredito que fosse um ornitolestes. Como você sabe, esse animal não está na lista — um achado extremamente significativo.

        Olhou em volta, mas não viu ninguém por perto, ninguém prestando atenção nele. Continuou: "Além disso, havia um corte profundo na parte lateral do fêmur. Isso é extremamente estranho." Hesitou, não querendo falar demais. "E estou enviando uma amostra que precisa ser examinada. Penso também que outras pessoas estejam interessadas. Seja como for, o que está acontecendo aqui é algo novo, Ian. Há mais de um ano não aparecia nenhum espécime e agora estão voltando a aparecer. Algo novo está acontecendo. E nós não compreendemos o que é."

        Ou será que compreendemos?, pensou Levine. Desligou o telefone e o guardou na bolsa externa da mochila. Talvez, pensou ele, saibamos mais do que pensamos. Olhou pensativamente para o portão de embarque. Estava na hora de tomar o avião.

       

       PALO ALTO

        Às duas horas da manhã, Ed James entrou no estacionamento quase deserto do Marie Callender, na Carter Road. O BM Wpreto já estava lá, estacionado perto da entrada. De onde estava ele avistou Dodgson sentado a uma mesa entre divisórias baixas, no restaurante, o rosto de traços pouco marcados contraído. Dodgson nunca estava de bom humor. Naquele momento ele falava com o homem enorme que estava ao seu lado e olhava impaciente para o relógio. O homem grande era Baselton. O professor que aparecia sempre na televisão. James ficava mais tranqüilo quando o professor estava presente. Dodgson dava calafrios a qualquer um, mas era difícil imaginar Baselton envolvido com alguma coisa irregular.

        James desligou o motor e abaixou o retrovisor para abotoar o colarinho e pôr a gravata. Olhou para o espelho rapidamente — um homem cansado e despenteado com uma barba de dois dias. Que diabo, pensou. Como não parecer cansado? Já era o meio da maldita noite.

        Dodgson sempre marcava os encontros para o meio da noite e sempre no mesmo bendito restaurante, Marie Callender. James não entendia por quê. O café era horrível. Mas afinal havia muita coisa que ele não entendia.

        Apanhou o envelope de papel pardo, saiu do carro e bateu a porta. Caminhou para a entrada, balançando a cabeça. Há semanas Dodgson estava pagando a ele quinhentos dólares por dia para vigiar alguns cientistas. No começo, James pensou que fosse um tipo de espionagem industrial. Mas nenhum dos cientistas trabalhava para a indústria, todos eram professores da universidade, especializados em matérias extremamente áridas. Como aquela paleobotânica Sattler, cuja especialidade eram grãos de pólen pré-histórico. James havia assistido a uma das suas aulas na Berkeley e mal conseguiu ficar acordado até o fim. Um slide após o outro de esferas pálidas que pareciam bolas de algodão, enquanto ela falava sem parar sobre ângulos de ligação de polissacarídeos e sobre a fronteira Campanian-Maastrichtian. Jesus, era uma chatice.

        Certamente não valia quinhentos dólares por dia, pensou ele. Entrou no restaurante, piscando para a luz, e foi direto para a mesa de Dodgson. Sentou, cumprimentou os dois homens com uma inclinação da cabeça e levantou a mão para pedir café.

        Dodgson olhou furioso para ele.    

          — Eu não tenho a noite toda — ele disse. — Vamos começar.

        — Certo — disse James, abaixando a mão. — Ótimo, claro. — Abriu o envelope e começou a tirar papéis e fotos, que ia entregando para Dodgson enquanto falava.

        — Alan Grant: paleontólogo na Universidade de Montana. No momento está de licença em Paris, fazendo palestras sobre os últimos dinossauros descobertos. Aparentemente tem algumas idéias novas sobre o fato de os tiranossauros serem necrófagos e...

        — Deixe pra lá — disse Dodgson. — Vamos adiante.

        — Ellen Sattler Reiman — disse James, empurrando para ele uma foto. — Botânica, teve um envolvimento com Grant. Agora está casada com um físico da Berkeley e tem um casal de filhos pequenos. Ela leciona meio-período na universidade. Passa o resto do tempo em casa porque...

        — Adiante, adiante.

        — Bem. Quase todos os outros estão mortos. Donald Gennaro, advogado... morreu de disenteria numa viagem de negócios. Dennis Nedry, Integrated Computer Systems... também morto. John Hammond, que fundou a International Genetic Technologies... morreu quando visitava o complexo de pesquisa da empresa, na Costa Rica. Hammond estava com os netos. Os netos moram com a mãe no Leste e...

        — Alguém entrou em contato com eles? Alguém da InGen?

        — Não. Nenhum contato. O garoto está começando o segundo grau e a menina está na escola preparatória. Então a InGen entrou com pedido de concordata, depois da morte de Hammond. Está nos tribunais desde a morte dele. Os bens materiais finalmente começaram a ser vendidos. Nas duas últimas semanas, para ser exato. Baselton falou pela primeira vez.

        — O Sítio B está envolvido na venda?       

        James não entendeu.                               

        —  Sítio B?                                                                      

        — Sim. Ninguém mencionou o Sítio B?   

        — Não, nunca ouvi falar. O que é?

        — Se ouvir alguma coisa sobre o Sítio B, queremos saber — disse Baselton.

        Sentado ao lado de Baselton, Dodgson olhou rapidamente para as fotos e os papéis com informações, depois empurrou tudo para o lado, impaciente, e olhou para James.

        — O que mais você tem?

        — Isso é tudo, Dr. Dodgson.

        —  Isso é tudo? Nada sobre Malcolm? E Levine? Ainda são amigos?

        James consultou suas anotações.

        — Não tenho certeza. Baselton franziu a testa.

        — Não tem certeza? O que quer dizer com isso?

        —  Malcolm conheceu Levine no Instituto Santa Fé — disse James. — Passaram algum tempo lá há dois anos mais ou menos. Mas Malcolm não tem estado em Santa Fé recentemente. Está dando uma série de palestras na Berkeley como professor visitante do departamento de biologia. Leciona modelos matemáticos da evolução. E ao que parece perdeu contato com Levine.

        — Eles cortaram relações?

        —  Talvez. Ouvi dizer que discutiram sobre a expedição de Levine.

        — Que expedição? — perguntou Dodgson, inclinando-se para a frente.

        — Há um ano mais ou menos Levine está planejando um tipo de expedição. Encomendou veículos especiais a uma empresa chamada Mobile Field Systems. É uma fábrica pequena em Wnodside, dirigida por um cara chamado Jack Thorne. Thorne adapta jipes e caminhões para cientistas que fazem pesquisa de campo. Cientistas na África, Sichuan e no Chile garantem a qualidade do seu trabalho.

        — Malcolm sabe da expedição?

        — Deve saber. Ele vai ocasionalmente à empresa de Thorne. Uma vez por mês, mais ou menos. E Levine tem ido lá todos os dias, é claro. Foi assim que ele foi parar na cadeia.

        — Na cadeia? — perguntou Baselton.

        — Isso mesmo — disse James, consultando suas anotações. — Vejamos. Dez de fevereiro. Levine foi detido por dirigir a cento e noventa numa zona de velocidade máxima permitida de vinte quilômetros. Bem na frente de um colégio em Woodside. O juiz apreendeu a Ferrari dele, tirou sua licença e o condenou a prestar serviços à comunidade. Basicamente, ordenou que desse aulas no colégio.

        Baselton sorriu.

        — Richard Levine lecionando num colégio. Eu gostaria de ver.

        — Ele tem cumprido a pena conscienciosamente. De qualquer modo, tem passado muito tempo em Woodside. Isto é, até sair do país.

        — Quando ele saiu do país? — perguntou Dodgson.

        — Há dois dias. Foi à Costa Rica. Viagem rápida. Devia voltar esta manhã.

        — E onde ele está agora?

        — Eu não sei. E acho que, bem, não vai ser fácil encontrá-lo.

        — Por quê?

        James hesitou, tossiu.

        — Porque seu nome constava da relação de passageiros do vôo da Costa Rica, mas ele não estava a bordo quando o avião chegou aqui. Meu contato na Costa Rica diz que ele saiu do hotel em San José antes da hora do vôo e não voltou. Não tomou nenhum outro avião para sair da cidade. Assim, neste momento, acho que Richard Levine desapareceu.

       

        Durante o longo silêncio que se seguiu, Dodgson recostou no banco, assobiando entre os dentes. Olhou para Baselton, que balançou a cabeça. Dodgson apanhou os papéis cuidadosamente e os empilhou, batendo-os na mesa. Depois os guardou no envelope de papel pardo e entregou para James.

        — Agora escute, seu cretino filho da mãe — disse Dodgson. — Quero só uma coisa de você. E muito simples. Está ouvindo?

        James engoliu em seco.

        — Estou ouvindo.

        Dodgson inclinou-se sobre a mesa.

        — Encontre Levine — disse ele.

       

       BERKELEY

        Malcolm ergueu os olhos quando sua assistente Beverly entrou no escritório atulhado de livros e papéis. Ela estava acompanhada por um homem do DHL que carregava uma pequena caixa.

        —  Desculpe a intrusão, Dr. Malcolm, mas o senhor precisa assinar estes formulários... É aquela amostra da Costa Rica.

        Malcolm levantou e foi até o centro da sala, sem usar a bengala. Há algumas semanas ele vinha se exercitando para andar sem a bengala. Sentia ainda alguma dor na perna, mas estava resolvido a fazer progresso. Sua fisioterapeuta, Cindy, uma mulher sempre alegre e otimista, comentou:

        — Muito bem, Dr. Malcolm, depois de tantos anos finalmente parece que está motivado. O que está acontecendo?

        — Bem, você sabe — disse Malcolm. — Não posso depender de uma bengala para sempre.

        Mas a verdade era outra. A animação indestrutível de Levine pela hipótese do mundo perdido, seus telefonemas entusiasmados, a qualquer hora do dia ou da noite, levaram Malcolm a reconsiderar sua opinião sobre o assunto. E começou a acreditar que fosse possível — até mesmo provável — a existência de animais extintos em algum lugar remoto e até então não imaginado. Malcolm tinha suas razões para pensar assim, razões apenas sugeridas a Levine.

        Mas foi a possibilidade de existir esse local em outra ilha que o levou a se livrar da bengala. Queria estar preparado para uma futura visita a essa ilha. Assim, esforçava-se diariamente e com afinco para andar livremente.

        Ele e Levine haviam limitado a área de busca a uma fileira de ilhas costeiras da Costa Rica e o entusiasmo de Levine era cada vez mais intenso. Mas para Malcolm a possibilidade era ainda remota.

        Malcolm recusava-se a se entusiasmar enquanto não tivesse uma prova material definitiva — fotografias ou amostras reais de tecido — da existência de novos animais. Até agora não tinham nenhuma. Malcolm não sabia se estava desapontado ou aliviado.

        Porém agora Levine havia enviado uma amostra.

        Malcolm apanhou a prancheta do entregador e assinou rapidamente o formulário: Entrega de Material/Amostras: Pesquisa Biológica.

        O entregador disse.

        — Precisa verificar as caixas, senhor.

        Malcolm olhou para a lista de perguntas, cada uma com um quadrado na frente para checar. O espécime é vivo? O espécime consta de cultura de bactérias, fungos, vírus ou protozoários? O espécime está registrado de acordo com o protocolo de pesquisa? O espécime é contagioso? O espécime foi retirado de uma fazenda ou de algum lugar de criação de animais domésticos? O espécime é matéria vegetal, sementes propagadoras ou bulbos? O espécime é um inseto ou relacionado com insetos...

        Malcolm respondeu não a todas as perguntas.

        — E a página seguinte, senhor — disse o entregador. Ele olhou em volta, para o escritório, para as pilhas desordenadas de papéis, os mapas nas paredes com alfinetes de cabeças coloridas. — Fazem pesquisas médicas aqui?

        Malcolm virou a página do formulário e assinou na parte inferior da segunda.

        — Não.

        — Mais um, senhor...

        A terceira página era um recibo de quitação de responsabilidade para a agência entregadora. Malcolm assinou também. O homem disse:

        — Um bom-dia para o senhor — e saiu. Imediatamente Malcolm relaxou o corpo, apoiando-se na mesa, e fez uma careta.

        — Ainda sente dor? — perguntou Beverly. Ela levou o espécime até a mesa e começou a desembrulhar.

        — Eu estou bem. — Olhou para a bengala ao lado da cadeira, depois respirou fundo e atravessou a sala, lentamente.

        Beverly retirou o papel do pequeno cilindro de aço inoxidável do tamanho de um punho fechado, com o sinal de risco biológico na tampa superior, de atarraxar. Ligado ao cilindro, havia um pequeno recipiente de metal com uma válvula também de metal que continha o gás refrigerador.

        Malcolm virou a lâmpada de mesa para o cilindro e disse:

        —  Vamos ver o que o deixou tão entusiasmado. — Partiu o lacre e desaparafusou a tampa. O gás foi liberado com um pequeno silvo e uma nuvem de condensação. O exterior do cilindro foi coberto por uma fina lâmina de gelo.

        Malcolm olhou para dentro. Havia um pequeno saco de plástico e uma folha de papel. Virou o cilindro de cabeça para baixo, deixando cair o conteúdo na mesa. Dentro do plástico estava um pedaço de carne esverdeada com cerca de cinco centímetros quadrados, com uma pequena etiqueta de plástico verde. Malcolm o ergueu contra a luz, examinou com a lente de aumento e pôs na mesa outra vez. Olhou para a pele esverdeada, para a textura irregular. Talvez, pensou.

        Talvez...

        — Beverly — disse ele —, telefone para Elizabeth Gelman, no zoológico. Diga que quero que ela examine uma coisa para mim. E diga que é confidencial.

        Beverly saiu da sala para telefonar. Sozinho, Malcolm desenrolou o papel que acompanhava a amostra. Era uma folha de um bloco de anotações e dizia, em letras maiúsculas:

        EU ESTAVA CERTO, E VOCÊ ESTAVA ERRADO.

        Malcolm franziu a testa. Aquele filho da mãe, pensou ele.

        —  Beverly? Depois de falar com Elizabeth, telefone para o escritório de Levine. Preciso falar com ele imediatamente.

       

       O MUNDO PERDIDO

        Richard Levine encostou o rosto na rocha quente e parou para tomar fôlego. Cento e cinqüenta metros abaixo estava o oceano, as ondas cintilantes batendo com força nas rochas escuras. O barco que o havia levado até ali era um pequeno ponto no horizonte, seguindo para leste. Tinha de voltar, pois não havia nenhum local seguro para atracar naquela ilha deserta e inóspita.

        Agora eles estavam sozinhos.

        Levine respirou fundo e olhou para Diego, seis metros abaixo na face do rochedo. Diego, jovem e forte, carregava a mochila com todo o equipamento. Ele sorriu alegremente e olhou para cima.

        —  Coragem, senor. Estamos perto agora.

        — Espero que sim — disse Levine.

        Quando ele observara o rochedo com o binóculo, do barco, aquele parecia um bom caminho para a escalada. Mas na realidade a face da rocha era quase vertical e incrivelmente perigosa porque a rocha vulcânica era insegura e friável.

        Levine ergueu os braços estendendo as mãos para o próximo ponto de apoio. Segurou a rocha, pequenas pedras se soltaram, e sua mão deslizou para baixo. Ele agarrou outra vez e ergueu o corpo, com a respiração ofegante por causa do esforço e do medo.

        — Só mais vinte metros, senor — encorajou Diego. — O senor vai conseguir.

        —  Claro que vou — resmungou Levine. — Considerando a alternativa...

        A medida que se aproximava do topo do rochedo, o vento ficava mais forte, assobiando nos seus ouvidos, puxando sua roupa, como se quisesse arrancá-lo da rocha. Olhou para cima e viu a folhagem densa que chegava até a margem da face da pedra.

        Quase chegando, pensou. Quase.

        Então, com um impulso final para cima, chegou ao topo e ficou imóvel, deitado na relva macia e molhada. Ainda respirando com dificuldade, olhou para baixo. Diego subiu com facilidade e leveza, agachou no tapete de folhagem e sorriu. Levine olhou para as imensas samambaias acima da sua cabeça, respirando longa e tremulamente para aliviar a tensão da escalada. Suas pernas estavam em fogo.

        Mas não importava — estava ali finalmente!

        Olhou para a selva. Era uma floresta primitiva, não tocada pela mão do homem. Exatamente o que as imagens do satélite haviam mostrado. Levine foi obrigado a confiar nas fotos do satélite porque não havia mapas de ilhas particulares como aquela. A ilha existia numa espécie de mundo perdido, isolada no meio do Oceano Pacífico.

        Levine ouviu o som do vento, o farfalhar das folhas das palmeiras, com as gotas de água pingando no seu rosto. Depois ouviu outro som, distante, como o grito de um pássaro, porém mais profundo, mais ressonante. Prestou atenção e o som se repetiu.

        Ouviu outro ruído ao seu lado e virou rapidamente. Diego acabava de riscar um fósforo para acender o cigarro. Levine sentou de repente, empurrou a mão de Diego e balançou a cabeça.

        Diego olhou para ele, intrigado.

        Levine levou um dedo aos lábios.

        Apontou na direção do grito do pássaro.

        Diego deu de ombros, desinteressado. Aparentemente não vi motivo para se preocupar.

        Ele não sabe ainda o que vamos enfrentar, pensou Levine abrindo a sacola e começando a montar seu rifle Lindstradt, fabri cado especialmente para ele na Suécia e que representava a mais nova tecnologia para controle de animais. Atarraxou o cano ao cabo travou o mecanismo de disparo, verificou a carga de gás e entregou o rifle para Diego. O rapaz o aceitou com outro erguer de ombro

        Levine tirou da mochila a pistola Lindstradt, preta e à prova de ferrugem, com o cinto de couro, e a prendeu na cintura. Tirou a  pistola do coldre, verificou o pino de segurança duas vezes e devolveu ao coldre. Levantou e fez sinal para Diego segui-lo. Diego fechou o zíper da mochila e a colocou nas costas.

        Os dois homens começaram a descer a encosta, afastando-se do rochedo. Quase imediatamente suas roupas ficaram completamente molhadas em contato com a folhagem. Estavam no meio da selva densa e só enxergavam alguns metros à frente. As folhas das samambaias eram enormes, longas e largas, com a envergadura de um homem. As plantas tinham três metros de altura e hastes ásperas e pontiagudas. E no alto, acima das samambaias, as copas das árvores bloqueavam quase completamente a luz do sol. Moviam-se no escuro, em silêncio, na terra úmida e esponjosa.

        Levine parava freqüentemente para consultar a bússola. Seguiam para oeste, descendo uma encosta íngreme, na direção do interior da ilha, Ele sabia que a ilha era o que restava de uma antiga cratera vulcânica, exposta à erosão durante séculos. A área interna consistia numa série de cordilheiras baixas que levavam ao chão da Á cratera. Porém, especialmente ali, no lado leste, o solo era íngreme, acidentado e traiçoeiro.

        A sensação de isolamento, de estar de volta ao mundo primitivo, era palpável. Com o coração batendo forte, Levine desceu a encosta, atravessou um regato cheio de musgo e começou a subir novamente. No topo da cordilheira seguinte havia uma abertura na folhagem e uma brisa reparadora. De onde estava, no alto, ele via a outra extremidade da ilha, uma linha de rochedos negros, a quilômetros de distância. Entre ele e os rochedos via apenas a selva ondulante. Ao lado dele, Diego disse:

        — Fantástico.      

        Levine rapidamente fez um sinal de silêncio.    

          - Mas, senor — protestou Diego, apontando para a vista. — Estamos sozinhos aqui.

         Levine balançou a cabeça com impaciência. Já havia explicado tudo isso a Diego durante a viagem de barco. Uma vez chegando à ilha, não deviam falar. Nada de fixador de cabelo, água de colônia ou cigarros. Toda a comida estava hermeticamente fechada em sacos de plástico. Tudo acondicionado cuidadosamente. Nada que pudesse exalar cheiro, nada que fizesse qualquer ruído. Vezes sem conta ele havia explicado a Diego a importância dessas precauções.

        Mas era óbvio agora que Diego não prestara a menor atenção. Ele não compreendia. Levine tocou Diego com o cotovelo e balançou a cabeça outra vez, irritado.

        Diego sorriu.

        — Senor, por favor. Só há pássaros aqui.

        Nesse momento ouviram um som profundo e trovejante, um grito que parecia extraterreno, vindo de algum lugar da floresta, abaixo de onde estavam. Depois de um momento, responderam-lhe do outro lado da floresta.

        Diego arregalou os olhos.

        Levine disse só com um movimento dos lábios, "Pássaros ?"

        Diego ficou calado, mordeu o lábio e olhou para a floresta.

        Ao sul as copas das árvores começaram a se mover, uma parte da floresta de repente adquiriu vida, como que roçada pelo vento. Mas o resto continuava imóvel. Não era o vento.

        Diego fez o sinal da cruz.

        Ouviram mais gritos, cada um com a duração de um minuto mais ou menos; depois, silêncio outra vez.

        Levine desceu da pequena elevação e começou a descer a encosta, penetrando mais no interior da selva.

       

        Levine caminhava rapidamente, olhando para o chão por causa das cobras, quando ouviu um assobio surdo. Virou para trás e viu Diego apontando para a esquerda.

        Levine voltou, abrindo caminho entre a folhagem, e seguiu Diego para o sul. Logo chegaram a duas trilhas paralelas há muito tempo tomadas pela relva e pelas samambaias, mas perfeitamente visíveis. Marcas de pneus de jipe, saindo da selva. É claro que seguiriam por ela. Andariam muito mais depressa numa estrada.

        Levine fez um gesto e Diego tirou a mochila das costas. Era a vez do cientista carregar o peso e ele passou as tiras pelos ombros e prendeu as fivelas.

        Em silêncio, seguiram pela trilha.

        Em certos lugares mal podiam ver as marcas do jipe, cobertas pela vegetação espessa. Era evidente que ninguém transitava por ali há anos e a selva estava sempre pronta para recuperar o espaço perdido.

        Atrás dele Diego resmungou e praguejou em voz baixa. Levine voltou-se e viu Diego levantar o pé com cuidado. Tinha pisado num monte de excremento verde de animal. Levine voltou.

        Diego passou o pé nas samambaias para limpar a bota suja até o tornozelo. O excremento parecia consistir em pedaços claros de feno misturado com alguma coisa verde. O material era leve e fragmentado — seco, antigo. Não tinha cheiro.

        Levine examinou o solo até encontrar os restos das marcas da passagem do animal. Os excrementos eram bem-formados, com vinte centímetros de diâmetro. Definitivamente, de um herbívoro de grande porte.

        Diego estava em silêncio, mas de olhos arregalados.

        Levine balançou a cabeça e continuou a andar. Enquanto estivessem encontrando sinais evidentes de herbívoros, não ia se preocupar. Pelo menos, não muito. Mesmo assim, tocou o cabo da pistola, como para se tranqüilizar.

       

        Chegaram a um regato com margens lamacentas nos dois lados. Levine parou. Na lama havia marcas definidas de pés de animais, com três dedos, algumas delas bem grandes. Sua mão aberta não chegava a cobrir completamente as pegadas.

        Ergueu os olhos e viu Diego fazendo o sinal da cruz outra vez, segurando o rifle com a outra mão.

        Esperaram, ouvindo o murmúrio suave do regato. Alguma coisa brilhou na água. Levine se inclinou para a frente e apanhou um pedaço de tubo de vidro do tamanho de um lápis, com uma das extremidades quebradas e marcas graduadas num dos lados. Era uma pípeta, do tipo usado nos laboratórios de todo o mundo, Levine a ergueu contra a luz, girando-a entre os dedos. Estranho, pensou ele. Uma pipeta de laboratório sugeria...

        Virou para o lado a tempo de notar um rápido movimento. Algo pequeno e marrom corria sobre a lama da margem do regato. Mais ou menos do tamanho de um rato.

        Diego resmungou surpreso. Então, o animal desapareceu entre a folhagem.

        Levine agachou na lama ao lado da água e examinou as marcas dos pés deixadas pelo pequeno animal. Pés com três dedos, como os de um pássaro. Viu outras marcas iguais, algumas maiores, a poucos centímetros de distância.

        Levine já vira essas marcas antes, nas trilhas do rio Purgatoire, no Colorado, onde a antiga linha da costa estava agora fossilizada, com as pegadas dos dinossauros perpetuadas nas pedras. Mas essas estavam na lama, eram recentes e feitas por animais vivos.

        Sentado nos calcanhares, Levine ouviu um leve rangido à sua direita. Viu o movimento suave das samambaias. Ficou imóvel, esperando.

        Depois de algum tempo um animal espiou entre as samambaias. Parecia do tamanho de um camundongo, a pele lisa e sem pêlos, e olhos muito grandes bem no alto da cabeça pequenina. Era marrom-esverdeado e guinchou para Levine, com um ruído contínuo e irritante, como procurando afastá-lo. Levine ficou imóvel, quase sem respirar.

        E claro que ele reconheceu a criatura. Era um mussauro, um pequeno prossaurópodo de fins do Triássico. Restos de esqueletos desse animal só foram encontrados na América do Sul. Era um dos menores dinossauros conhecidos.

        Um dinossauro, pensou ele.

        Embora esperasse encontrar dinossauros na ilha, era assustador estar frente a frente com um membro vivo e ativo da espécie Dinosauria. Especialmente um tão pequeno. Mesmerizado, Levine não tirava os olhos do animal. Depois de todos aqueles anos, depois de todos os esqueletos empoeirados — um dinossauro realmente vivo!

        O pequeno mussauro avançou um pouco, aventurando-se a deixar a proteção da folhagem. Levine viu então que ele era mais comprido que o que tinha pensado. Devia ter uns dez centímetros de comprimento, com a cauda surpreendentemente forte. No aspecto geral, parecia um lagarto. Sentou ereto, apoiado nas patas traseiras. Levine viu o movimento das costelas acompanhando a respiração. O animal agitou as pernas dianteiras para Levine, guinchando sem parar.

        Lentamente, muito lentamente, Levine estendeu a mão.

        A criatura guinchou outra vez, mas não fugiu. Tudo o que parecia demonstrar era curiosidade, inclinando a cabeça para o lado, como fazem os animais pequenos, quando a mão de Levine chegou mais perto.

        Finalmente os dedos de Levine tocaram a ponta da samambaia. O mussauro ficou de pé, equilibrando-se na cauda estendida. Sem o menor sinal de medo, ele subiu na mão de Levine. Era extremamente leve. O mussauro deu uma volta na palma de Levine e cheirou os dedos. Levine sorriu, encantado.

        De repente, a pequena criatura guinchou irritada, saltou da mão de Levine e desapareceu entre as árvores. Levine não compreendeu por quê.

        Então sentiu um cheiro horrível e percebeu um movimento nos arbustos, no outro lado. Ouviu um rosnado surdo. Mais movimento entre os arbustos.

        Por um breve momento Levine lembrou que os carnívoros selvagens costumam caçar perto dos rios e regatos, aproveitando a vulnerabilidade da presa, inclinada para beber. Mas era tarde demais. Ouviu um brado estridente e apavorante e quando se voltou viu Diego aos gritos, sendo arrastado para os arbustos, que se agitavam violentamente. Levine viu de relance um pé enorme com o dedo médio em forma de garra curva. Então o pé desapareceu. Os arbustos continuaram a se agitar.

        De repente, a floresta em volta dele explodiu em rugidos de animais assustados. Viu um vulto enorme saltando para ele. Richard Levine virou e correu, sabendo que não podia escapar. Algo pesado agarrou a mochila e ele caiu de joelhos na lama, compreendendo naquela fração de segundo que, a despeito de todo planejamento, apesar de todas as suas deduções inteligentes, as coisas tinham saído terrivelmente erradas e ele ia morrer.

       

       A ESCOLA

        "Quando consideramos a extinção em massa provocada pelo impacto de um meteoro", disse Richard Levine, "devemos fazer várias perguntas. Em primeiro lugar, existe no nosso planeta alguma cratera resultante da queda de um meteoro com mais de 30 quilômetros de diâmetro — o menor tamanho necessário para provocar uma extinção de âmbito mundial? Acontece que existem uma dúzia de crateras desse tamanho no mundo todo, cinco das quais coincidem com períodos da extinção conhecidos..."

        Kelly Curtis bocejou no escuro da sua classe da sétima série do primeiro grau. Sentada à mesa, com o queixo apoiado nas mãos cruzadas, ela se esforçava para não dormir. Já conhecia toda aquela matéria. A televisão na frente da classe mostrava a vista aérea de um vasto milharal com os contornos curvos levemente visíveis. Ela sabia que era a cratera de Manson. No escuro, a voz gravada do Dr. Levine dizia: "Esta é a cratera de Manson, Iowa, datada de sessenta e cinco milhões de anos, exatamente quando os dinossauros foram extintos. Mas teria sido o meteoro o responsável pela extinção?"

        Não, pensou Kelly, bocejando. Provavelmente a península de Yucatán. Manson era pequeno demais.

        "Hoje pensamos que esta cratera é demasiado pequena", disse o Dr. Levine. "Acreditamos que seja demasiado pequena numa ordem de magnitude, e a candidata atual é a cratera perto de Mérida, na península de Yucatán. Parece difícil imaginar, mas o impacto esvaziou todo o Golfo do México, provocando ondas de seiscentos e dez metros que se lançaram sobre a terra. Deve ter sido um espetáculo incrível. Porém há divergências a respeito desta cratera também, especialmente no que diz respeito ao significado da estrutura em forma de poço natural e às diferenças nos índices de mortandade do fitoplâncton nos depósitos dos oceanos. Pode parecer complicado, mas não se preocupem com isso agora. Falaremos a respeito com maiores detalhes na próxima aula. Assim, por hoje é tudo."

        As luzes se acenderam. A professora, a Sra. Menzies, desligou o computador que estava transmitindo a aula.

        — Muito bem — disse ela. — Ainda bem que o Dr. Levine nos mandou esta gravação. Ele me disse que talvez não voltasse em tempo para a aula de hoje, mas certamente estará conosco na próxima semana, depois dos feriados, Kelly, você e Arby trabalham com o Dr. Levine. Foi isso o que ele disse?

        Kelly olhou para Arby, que estava recostado na cadeira e franziu a testa.

        — Sim, Sra. Menzies — afirmou Kelly.

        —  Ótimo. Muito bem. O dever para os feriados será todo o capítulo sete — gemidos gerais —, incluindo todos os exercícios no fim da primeira e da segunda parte. Não deixem de trazer a lição completa quando voltarem às aulas. Aproveitem bem os feriados. Nós nos veremos novamente aqui dentro de uma semana.

        A campainha soou, a turma se levantou, arrastando as cadeiras, na sala de repente barulhenta. Arby se aproximou de Kelly e olhou para ela tristemente. Arby era quase uma cabeça mais baixo do que Kelly, o menor da classe e também o mais novo. Kelly tinha treze anos, como os outros alunos da sétima série, mas Arby tinha só onze. Era tão inteligente que já havia saltado duas séries. E diziam que ia saltar mais uma. Arby era um gênio, especialmente com computadores.

        Arby guardou a caneta no bolso da camisa social e empurrou para cima os óculos de aros de tartaruga. R. B. Benton era negro, NCU pai e sua mãe eram médicos em San José e faziam questão de que ele estivesse sempre bem-vestido, como um aluno de faculdade ou coisa parecida. O que, pensou Kelly, ele sem dúvida seria dentro de dois anos, se continuasse nesse ritmo.

        Kelly sempre se sentia mal vestida e desajeitada ao lado de Arby. Ela usava as roupas da irmã mais velha, compradas na Kmart, pela mãe, há milhões de anos. Tinha até de usar os velhos Reeboks de Emily, tão velhos e encardidos que nunca pareciam limpos, nem quando saíam da máquina de lavar. Sua mãe quase nunca estava em casa. Kelly olhou com inveja para a calça de Arby, impecavelmente passada, os tênis brilhantes, e suspirou.

        Porém, apesar da inveja que sentia, Arby era seu único amigo verdadeiro — a única pessoa que aceitava o fato de ela ser inteligente. Kelly tinha medo de nunca mais vê-lo se ele saltasse para a nona série.

        Arby parecia preocupado. Olhou para ela e disse:

        — Por que o Dr. Levine não está aqui?

        — Eu não sei. Talvez tenha acontecido alguma coisa.

        — O quê, por exemplo?                                                      

        — Eu não sei. Qualquer coisa.

        — Mas ele prometeu que estaria aqui — disse Arby. — Para nos levar numa excursão de estudo de campo. Estava tudo combinado. Conseguimos permissão e tudo o mais.

        — E daí? Ainda podemos ir.

        — Mas ele devia estar aqui — insistiu Arby, teimosamente.

        Kelly já conhecia aquele comportamento. Arby estava acostumado a confiar nos adultos. Seus pais eram completamente dignos de confiança. Mas Kelly não tinha esse problema.

        — Deixe pra lá, Arby. Vamos falar pessoalmente com o Dr. Thorne.

        — Acha que devemos?

        — Claro. Por que não? Arby hesitou.

        — Talvez seja melhor eu telefonar para minha mãe primeiro.

        — Por quê? Sabe que ela vai dizer para você ir direto para casa. Venha, Arby. Vamos.

        Ele hesitou, ainda indeciso. Arby podia ser inteligente, mas qualquer mudança de planos o perturbava. Kelly sabia por experiência que ele ia resmungar e discutir o tempo todo se ela fosse demasiado insistente. Precisava esperar que ele resolvesse.

        — Tudo bem — Arby disse, finalmente. — Vamos falar com o Dr. Thorne.

        Kelly disse, com um largo sorriso:

        — Encontro você na frente, em cinco minutos.

            

        Quando desceu a escada para o primeiro andar, a cantilena recomeçou: "Kelly é um crânio, Kelly é um crânio..."

        Ela ergueu a cabeça. Era aquela idiota da Allison Stone com suas amigas idiotas, no fim da escada, provocando-a.

        "Kelly é um crânio..."

        Passou por elas, ignorando a provocação. Viu a Srta. Enders, a monitora, ali perto, como sempre não dando a menor atenção, embora o Sr. Canosa, o assistente do diretor, tivesse recentemente advertido toda a escola a respeito de provocações desse tipo.

        Atrás dela, as meninas continuaram: "Kelly é um crânio... Ela é a rainha... da tela... e vai ficar verde..." Todas se torciam de rir.

        Viu Arby à sua espera ao lado da porta com um maço de cabos cinzentos na mão. Kelly se apressou.                                         

        Quando chegou perto dele, Arby disse:

        — Esqueça.

        — Elas são umas cretinas idiotas.

        — Certo.

        — Eu não me importo mesmo.

        — Eu sei. Esqueça.

        Atrás deles as meninas riam. "Kel-ly e Ar-by.... vão a uma festa... dar um banho de matemática..."

        Saíram para a luz do sol e as vozes foram abafadas pela confusão da saída da escola. Os ônibus amarelos esperavam no estacionamento. Crianças desciam a escada e corriam para os carros dos pais estacionados em volta da quadra. Era grande a atividade.

        Arby se desviou de um Frisbee que passou por cima de sua cabeça e olhou para a rua.

        — Lá está ele outra vez.

        — Não olhe — disse Kelly.

        —  Não estou olhando.                                                         

        —  Lembre-se do que o Dr. Levine disse.

        — Nossa, Kel, eu me lembro, está bem?

        No outro lado da rua estava parado um Taurus cinzento que há dois meses Kelly e Arby viam uma vez ou outra. O motorista, que fingia ler um jornal, era o mesmo homem de barbicha rala. Esse homem estava seguindo o Dr. Levine desde que ele começara a dar aulas na escola de Woodside. Kelly achava que fora especialmente por isso que ele tinha pedido a ela e a Arby que fossem seus assistentes.

       

        Levine havia dito que eles iam ajudá-lo a carregar equipamento, tirar xerox dos deveres de classe, recolher os trabalhos de casa e outras tarefas de rotina. Para eles era uma grande honra trabalhar para o Dr. Levine— ou, de qualquer modo, seria interessante trabalhar para um cientista profissional —, e por isso aceitaram.

        Mas acontece que não tinham nada para fazer na classe. O Dr. Levine fazia tudo. Em vez do trabalho combinado, ele os encarregava de pequenas tarefas fora da classe. E recomendou que ficassem longe do homem de barba no carro. Isso não era difícil. O homem nem olhava para eles porque eram crianças.

        O Dr. Levine explicou que o homem de barba o estava seguindo por causa de alguma coisa relacionada à sua prisão, mas Kelly não acreditou. Sua mãe fora detida duas vezes por dirigir embriagada e nunca fora seguida. Kelly não sabia por que o homem seguia o Dr. Levine, mas era evidente que o cientista estava fazendo alguma pesquisa e não queria que ninguém soubesse. De uma coisa Kelly sabia — o Dr. Levine não se importava muito com a classe. Geralmente dava a aula de improviso. Outras vezes, chegava até a porta da escola, entregava um disquete com a aula e ia embora. Eles não sabiam para onde ele ia nesses dias.

        As tarefas das quais o Dr. Levine os encarregava eram também misteriosas. Uma vez eles foram a Stanford para apanhar com um professor cinco pequenos quadrados de plástico. O plástico era leve, um pouco esponjoso. Outra vez foram ao centro da cidade, a uma loja de artigos eletrônicos, para apanhar um objeto triangular que o vendedor da loja entregou nervosamente, como se fosse uma coisa ilegal. Outra vez, ainda, foram apanhar um tubo de metal que parecia conter charutos. Curiosos, eles o abriram e ficaram preocupados quando encontraram quatro ampolas de plástico fechadas com um líquido cor de palha. Nas ampolas estava escrito: PERIGO EXTREMO! TOXIDEZ LETAL!, e tinha o símbolo de três lâminas que indicava risco biológico.

        Mas a maior parte das tarefas era comum. Muitas vezes ele os mandou a bibliotecas de Stanford para tirar xerox de trabalhos sobre diversos assuntos: fabricação de espadas pelos japoneses, raios X, cristalografia, morcegos vampiros mexicanos, vulcões da América Central, correntes oceânicas do El Nino, o acasalamento das ovelhas das montanhas, toxidez das holotúrias, arcobotantes das catedrais góticas...

        O Dr. Levine jamais explicava por que estava interessado nesses assuntos. Geralmente ele os mandava de volta dia após dia, à procura de mais material. E então, de repente, ele desistia do assunto e nunca mais falava nele. E os dois assistentes passavam para outras tarefas.

        É claro que alguma coisa eles compreendiam. Muitas das tarefas tinham a ver com o veículo que o Dr. Thorne estava fazendo para a expedição do Dr. Levine. Porém, na maior parte das vezes, os assuntos eram completamente misteriosos.

        Ocasionalmente Kelly imaginava o que o homem de barba pensava de tudo isso. Se ele sabia de alguma coisa que eles não sabiam. Mas, na verdade, o homem de barba parecia um pouco preguiçoso. Aparentemente jamais descobriu que Kelly e Arby estavam trabalhando para o Dr. Levine.

        Nesse momento, ele olhava para a porta da escola ignorando-os completamente. Os dois foram até o fim da rua e sentaram no banco para esperar o ônibus.

       

       A ETIQUETA

        O filhote de leopardo da neve cuspiu a mamadeira, rolou no chão, ficou de pernas para o ar e miou baixinho.

        — Ela quer carinho — disse Elizabeth Gelman.

        Malcolm estendeu a mão e acariciou a barriga do animalzinho. O filhote girou o corpo e cravou os pequenos dentes nos dedos dele.

        — Dorje! Menina malvada! É assim que trata uma visita importante? — Segurou a mão de Malcolm e a examinou. — Nem abriu a pele, mas mesmo assim vamos limpar.

        Estavam no laboratório de pesquisas do Zoológico de San Francisco. Eram três horas da tarde. Elizabeth Gelman, a jovem diretora do departamento de pesquisas, devia entregar o relatório com o resultado do exame da amostra, mas Malcolm teve de esperar porque era a hora de alimentar os filhotes. Malcolm viu os funcionários alimentarem um filhote de gorila, que cuspia como um bebê humano, um filhote de coala e finalmente o filhote de leopardo da neve.

        — Desculpe — disse Gelman, levando-o para a pia e lavando a mão dele com sabão. — Mas achei que era melhor você vir aqui nesta hora, quando toda a equipe está na reunião semanal.

        — Por quê?

        —  Por que há muito interesse no material que você nos mandou, Ian. Muito. — Enxugou a mão dele com uma toalha e examinou outra vez. — Acho que vai sobreviver.

        — O que você descobriu? — perguntou Malcolm.

        — Tem de admitir que é bastante interessante. A propósito, é da Costa Rica?

        Com voz inexpressiva, Malcolm disse:  

         — Por que pergunta?

        — Por causa de todos esse boatos sobre animais desconhecidos que têm aparecido na Costa Rica. E este é definitivamente um animal desconhecido, Ian.                                                        

        Saíram do berçário do zoológico e foram para uma pequena; sala de conferências. Malcolm sentou e encostou a bengala na mesa. Ela diminuiu as luzes e ligou o projetor de slides.           

        —  Muito bem. Aqui está um close do seu material original, antes de começarmos o exame. Como pode ver, consiste num fragmento de tecido animal em avançado estado de necrose. O tecido mede quatro por seis centímetros. Preso a ele há uma etiqueta de plástico verde de dois centímetros quadrados. Tecido cortado com uma faca não muito afiada.

        Malcolm balançou a cabeça, afirmativamente.

        — O que você usou, Malcolm? Um canivete?

        — Alguma coisa parecida.

        — Muito bem. Vamos primeiro ao tecido. — Passou para outro slide, que mostrava uma visão microscópica — Este é um corte histológico feito na epiderme superficial. Essas lacunas manchadas e de bordas irregulares indicam a erosão na superfície do tecido, provocada pelas alterações necróticas. Porém o interessante é a disposição das células epidérmicas. Pode-se ver a densidade dos cromatóforos ou células que contêm os pigmentos. Na parte seccionada vemos a diferença entre os melanóforos, aqui, e os alóforos, ali. O padrão geral sugere um lacertílio.

        — Quer dizer lagarto? — perguntou Malcolm.

        — Sim. Parece um lagarto, embora o quadro não seja inteiramente consistente. — Bateu com o dedo no lado esquerdo da tela. — Está vendo esta célula aqui, com uma margem levemente delineada no corte? Acreditamos que seja músculo. O cromatóforo pode abrir e fechar, isto é, este animal pode mudar de cor, como um camaleão. E aqui, está vendo esta forma grande, oval com centro descorado? É o poro de uma glândula femoral. No centro há uma substância cerosa que ainda estamos analisando. Mas supomos que o animal seja um macho, uma vez que só os lagartos machos possuem glândulas femorais.

        — Compreendo — disse Malcolm.                

        Ela passou para outro slide. Malcolm viu o que parecia o close de uma esponja.

        —  Veja aqui a estrutura das camadas subcutâneas. Muito distorcidas por causa das bolhas de gás da infecção por Clostridium, que provocou o entumescimento do corpo do animal. Mas dá para perceber os vasos — veja, um aqui e outro aqui — circundados por fibras musculares lisas. Isto não é característico dos lagartos. Na verdade, tudo o que aparece neste slide nada tem a ver com lagartos ou com qualquer tipo de réptil.

        — Está dizendo que parece um animal de sangue quente.

        — Certo — disse Gelman. — Não na realidade mamífero, mas talvez da espécie dos pássaros. Pode ser, oh, eu não sei, um pelicano morto. Alguma coisa assim.

        — Hum, hum.

        — Só que nenhum pelicano tem a pele igual a esta.

        — Compreendo — disse Malcolm.

        — E não há penas.

        — Hum, hum.

        — Agora — disse Gelman —, conseguimos extrair uma quantidade mínima de sangue das artérias. Não muito, mas o suficiente para conduzir um exame microscópico. Aqui está.

        Passou para outro slide. Malcolm viu um amontoado de células, a maioria glóbulos vermelhos e um ou outro glóbulo branco malformado. Um tanto confuso.

        — Esta não é a minha área, Elizabeth — ele disse.

        — Bem, vou citar apenas os pontos principais. Para começar, glóbulos vermelhos com núcleos. E uma característica das aves, não dos mamíferos. Segundo, hemoglobina bastante atípica, diferindo em vários pares tomados como base de outros lagartos. Terceiro ponto, estrutura aberrante dos glóbulos brancos. Não temos material suficiente para determinar com exatidão, mas suspeitamos que esse animal possua um sistema imunológico extremamente incomum.

        — E o que quer dizer isso? — Malcolm deu de ombros.

        — Não sabemos e a amostra não nos dá material suficiente para descobrir. A propósito, pode arranjar outra?

        — Talvez possa — disse ele.                                        

        — Onde, no Sítio B?                                                   

        — Sítio B? — perguntou Malcolm, intrigado.

        —  Bem, é o que diz a etiqueta. — Ela passou para o slide seguinte. — Devo dizer, Ian, que esta etiqueta é muito interessante. Aqui, no zoológico, costumamos pôr etiquetas nos animais e conhecemos todas as marcas comerciais usadas no mundo inteiro. Ninguém tinha visto esta etiqueta antes. Aqui está ela, aumentada dez vezes. O objeto tem o tamanho aproximado de uma unha do polegar. Superfície uniforme de plástico, pregada no animal por meio de um clipe de aço inoxidável forrado com Teflon no outro lado. É um clipe muito pequeno, do tipo usado para filhotes. O animal que você viu era adulto?

        — Supostamente.

        —  Então a etiqueta provavelmente foi pregada há algum tempo, quando o animal era novo — disse Gelman. — O que faz sentido, considerando o grau de uso que ela aparenta. Note as picadas na superfície. Não são comuns. Este plástico é Suralon, o material usado para capacetes de futebol americano. É extremamente duro, e estas picadas não podem ser o resultado apenas do uso.

        — De que então?

        — Tenho quase certeza de que se trata de uma reação química, como exposição a um ácido, talvez sob a forma de aerossol.

        —  Como vapor vulcânico? — perguntou Malcolm.

        — Pode ser, especialmente tendo em conta o resto que descobrimos. Pode ver que a etiqueta é bastante espessa — na verdade, tem nove milímetros de largura. E é oca.

        — Oca? — perguntou Malcolm, com estranheza.

        — Sim, contém uma cavidade interna. Não quisemos abrir, por isso tiramos uma radiografia. Aqui está. — O slide mudou e Malcolm viu um amontoado de linhas brancas e quadrados dentro da etiqueta.

        —  Parece ter havido bastante corrosão aqui também devido à ação de vapores ácidos. Mas não há dúvida do que isto era originalmente. E uma etiqueta de rádio, Ian. O que significa que este animal raro, este lagarto de sangue quente ou seja lá o que for, foi etiquetado e criado por alguém desde o nascimento. E foi isso que preocupou o pessoal aqui do nosso laboratório. A idéia de alguém criar uma coisa dessas. Você sabe o que aconteceu?

        — Não tenho a mínima idéia — disse Malcolm.

         Elizabeth Gelman suspirou.

        — Você é um filho da mãe mentiroso.

        Ele levantou a mão.

        — Pode devolver a minha amostra?

        — lan — disse ela. — Depois de tudo que fiz por você...

        — A amostra.

        — Acho que me deve uma explicação.

        — E eu prometo que terá. Dentro de duas semanas, mais ou menos. Eu pago o jantar.

        Ela jogou um embrulho de papel de alumínio na mesa. Ele o apanhou e guardou no bolso.

        —  Obrigado, Liz. — Malcolm levantou. — Detesto ter de ir agora, mas preciso dar um telefonema imediatamente.

        Ele caminhou para a porta e Elizabeth disse:

        — A propósito, como foi que ele morreu, Ian? Esse animal? Malcolm pensou por um momento.

        — Por que pergunta?

        — Porque, quando deslocamos as células da pele, encontramos algumas células estranhas sob a camada externa da epiderme. Células de outro animal.

        — O que significa isso?

        —  Bem, é um quadro típico de uma luta entre dois lagartos. Esfregam o corpo um no outro e as células penetram a camada superficial da pele.

        — Sim — ele disse. — Havia sinais de luta na carcaça. O animal estava ferido.

        —  E você deve saber que havia sinais de vasoconstrição crônica das artérias. Este animal estava sob grande estresse, Ian. E não apenas por causa da luta ou do ferimento. Se fosse, teria desaparecido nas primeiras alterações do post-mortem. Estou falando de estresse crônico, contínuo. Onde quer que ele vivesse, o meio ambiente era extremamente opressivo e perigoso.

        —  Compreendo.

        — Então, como um animal etiquetado podia levar uma vida tão estressante e cheia de perigos?

       

        Na entrada do zoológico ele olhou em volta para ver se estava sendo seguido, depois entrou na cabine telefônica e ligou para Levine. A secretária eletrônica atendeu. Levine não estava. Típico, pensou Malcolm. Levine nunca está quando precisamos dele. Provavelmente tentando outra vez recuperar a Ferrari confiscada pelo juiz.

        Malcolm desligou e foi para seu carro.

       

       THORNE

        Estava escrito "Thorne Mobile Field Systems", com letras pretas numa grande porta sanfonada de garagem, no fim do Parque Industrial. A esquerda havia uma porta comum. Arby tocou a campainha na pequena caixa com grade. Uma voz irritada disse:

        — Vá embora.

        — Somos nós, Dr. Thorne. Arby e Kelly.

        — Oh, está bem.

        Um estalo, a fechadura foi aberta e eles entraram no grande galpão aberto. Homens trabalhavam na modificação de vários veículos, o ar cheirava a acetileno, óleo de motor e tinta fresca. Logo à frente Kelly viu um Ford Explorer verde-escuro com uma abertura na capota. Dois assistentes no alto de escadas instalavam uma célula de luz solar na parte aberta do capo do carro. O capo estava aberto e os homens substituíam o motor V-6 por outro menor, que parecia uma caixa de sapatos revestida de liga de alumínio. Outros assistentes levavam o retângulo largo e plano do conversor Hughes para ser montado sobre o motor.

        À direita, Kelly viu dois trailers RV nos quais a equipe de Thorne trabalhava há duas semanas. Não eram iguais aos trailers comuns que as pessoas usam nas férias. Um era enorme e estreito, quase do tamanho de um ônibus, equipado com sala e quartos para quatro pessoas, além de todo o tipo de equipamento científico. Era o "Challenger", com uma propriedade especial. Quando estacionado, as paredes podiam ser afastadas para fora, aumentando o espaço interno.

        O Challenger podia puxar um trailer menor, ao qual era ligado por uma passagem em forma de sanfona. Esse segundo RV continha equipamento de laboratório e instrumentos de alta tecnologia, que Kelly não sabia ao certo para que serviam. Naquele momento, o segundo trailer estava quase escondido pelas fagulhas longas do soldador elétrico. Apesar de toda essa atividade, o trailer parecia quase terminado — mas ela podia ver homens trabalhando dentro dele, e todos os bancos e poltronas estavam no chão da oficina.

        Thorne, de pé no centro do galpão, gritava para o soldador no teto do trailer:

        —  Vamos, vamos, precisamos terminar hoje, Eddie, vamos com isso. — Voltou-se e gritou outra vez. — Não! Não! Veja o desenho do projeto! Henry, você não pode encaixar esse reforço lateralmente. Tem de ficar atravessado, para dar mais força. Consulte o projeto!

        O Dr. Thorne era um homem grisalho e forte de cinqüenta e cinco anos. A não ser pelos óculos de aros de metal, parecia um boxeador aposentado. Kelly mal podia imaginar Thorne como um professor universitário. Era um homem enorme, sempre em movimento.

        — Que droga, Henry! Henry, está me ouvindo?

        Thorne praguejou outra vez e balançou os punhos fechados. Voltou-se para os meninos.

        — Esses caras — disse ele — estão aqui supostamente para me ajudar! — Um estalo seco, como de um relâmpago, soou no Explorer. Os dois homens encostados no capo saltaram para o lado. Uma nuvem de fumaça subiu para o teto. — O que eu disse? — gritou Thorne. — Liguem o fio terra Liguem o fio terra antes de fazer qualquer coisa! Temos altas voltagens aqui, caras! Se não tiverem cuidado, vão ser fritos!

        Olhou outra vez para os meninos e balançou a cabeça.

        — Eles simplesmente não entendem. Esse DUI é uma defesa e tanto!

        — DUI?

        — Defesa ursina interna... foi o nome que Levine inventou. O que ele considera uma boa piada — disse Thorne. — Na verdade, eu inventei esse sistema há alguns anos para os guardas-florestais do parque Yellowstone, onde os ursos costumam arrombar os trailers. Um choque e tanto! Desanima qualquer urso, por maior que seja. Mas esse tipo de voltagem pode mandar esses homens para o ar. E depois? Sou processado e obrigado a pagar uma indenização. Pela estupidez deles. — Balançou a cabeça. — Então? Onde está Levine?

        — Nós não sabemos — disse Arby.                                   

        — Como não sabem? Ele não deu aula hoje?                    

        — Não, ele não apareceu. Thorne praguejou outra vez.

        — Bem, preciso dele hoje para as revisões finais, antes do teste de campo. Ele devia voltar hoje.

        — Voltar de onde? — perguntou Kelly,

        — Oh, de uma das suas pesquisas de campo — disse Thorne.

        —  Estava muito entusiasmado. Eu preparei o equipamento, emprestei minha mais nova mochila. Tudo do que ele pode precisar não pesa mais de vinte e cinco quilos. Ele gostou. Partiu na segunda-feira, há quatro dias.

        — Para onde?

        — Como vou saber? Ele não me disse. E eu desisti de perguntar. Vocês sabem que eles são todos iguais. Todo cientista que conheço é misterioso. Mas não se pode culpá-los por isso. Eles têm medo de ser roubados ou processados. O mundo moderno! No ano passado preparei o equipamento para uma expedição no Amazonas, todo à prova d'água — o que é necessário, na floresta tropical

        — aparelhos eletrônicos molhados não funcionam —, e o cientista chefe da expedição foi acusado de apropriação indébita de fundos. Por fazer todo o equipamento à prova d'água! Um burocrata universitário disse que era uma "despesa desnecessária". É como estou dizendo, é loucura. Loucura. Henry, será que não ouve nada do que eu digo? Ponha esse reforço atravessado*.

        Thorne atravessou o galpão, agitando os braços. Os meninos foram atrás.

        —  Mas agora olhem para isto — disse Thorne. — Há meses estamos modificando os veículos de campo para ele e finalmente terminamos. Ele quer que sejam leves, eu os fiz leves. Ele quer que sejam resistentes — leves e resistentes, por que não? É simplesmente impossível o que ele quer, mas, com bastante titânio e um composto de carbono, estamos fazendo o que ele quer. Ele quer sem nada à base de petróleo e sem radiador, e fizemos isso também. Assim, finalmente ele tem o que queria, um laboratório enorme e extremamente portátil para funcionar onde não existe gasolina nem eletricidade. E agora que está pronto... não acredito. Ele não apareceu mesmo para dar a aula?

        — Não — disse Kelly.

        — Então, Levine desapareceu. Que maravilha! Perfeito! E os testes de campo? íamos testar os veículos durante uma semana para deixar tudo no ponto certo.

        — Eu sei — disse Kelly. — Conseguimos permissão dos nossos pais e tudo o mais.

        — E agora ele não está aqui. — Thorne estava furioso. — Acho que eu devia esperar isso. Esses garotos ricos só fazem o que querem. Um cara como Levine faz com que a palavra mimado pareça um palavrão.

        Uma grande gaiola de metal despencou do teto, aterrissando perto deles. Thorne saltou para o lado.

        — Eddie! Que droga! Será que não pode ter cuidado?

        — Desculpe, doutor — disse Eddie Carr, no alto da gaiola. — Mas queremos ter certeza de que a armação não vai deformar a mil e duzentos psi. Temos de testar tudo.

        — Tudo bem, Eddie. Mas não faça os testes quando estamos debaixo deles! — Thorne se inclinou para examinar a gaiola circular, feita com barras de liga de titânio, com dois centímetros de espessura. Verificou que não fora avariada pela queda. E era leve. Thorne a ergueu com uma das mãos. Tinha cerca de um metro e oitenta de altura e um metro e vinte de diâmetro. Parecia uma enorme gaiola de passarinho com uma porta de dobradiças e uma fechadura pesada.

        — Para que serve isso? — perguntou Arby.

        — Na verdade — disse Thorne —, isso faz parte daquilo. — Apontou para o outro lado do galpão, onde um homem montava longarinas de alumínio numa estrutura telescópica. — Uma plataforma de observação, para ser montada no campo. Os andaimes, quando montados, formam uma estrutura rígida, a uns cinco metros de altura, com um pequeno abrigo na parte superior. Também telescópico.                                                                

        — Um posto de observação para observar o quê? — quis saber Arby.

        — Ele não disse para vocês? — perguntou Thorne.

        — Não — respondeu Kelly.

        — Não — disse Arby.

        — Bem, também não me disse. — Thorne balançou a cabeça. — Tudo o que sei é que ele quer tudo extremamente resistente. Leve e resistente, leve e resistente. Impossível. — Ele suspirou. — Deus me livre dos acadêmicos.

        — Pensei que você fosse um acadêmico — observou Kelly.

        — Ex-acadêmico — Thorne explicou secamente. — Agora eu faço coisas. Não fico só falando.

       

        Todos os conhecidos de Thorne concordavam em dizer que a aposentadoria marcara o início do período mais feliz da vida dele. Como professor de engenharia aplicada e especialista em materiais exóticos, ele sempre demonstrou sua orientação prática e seu amor pelos alunos. Seu curso mais famoso na Stanford, Engenharia Estrutural 101a, era conhecido entre os alunos como "Os Problemas de Thorne", porque Thorne estava sempre incentivando a classe a resolver os problemas de engenharia aplicada criados por ele. Alguns desses problemas pertenciam ao folclore dos alunos. Havia, por exemplo, o Desastre do Papel Higiênico: Thorne pediu aos alunos que atirassem uma caixa de papelão cheia de ovos do alto da torre Hoover sem quebrar os ovos. A única coisa que podiam usar para amortecer a queda seriam os tubos de papelão dos rolos de papel higiênico. A praça ficou cheia de ovos quebrados.

        Em outro ano, Thorne pediu aos alunos que construíssem uma cadeira que suportasse o peso de um homem de cem quilos, usando apenas cotonetes e linha. Outra vez, ele pendurou no teto a folha com os gabaritos do exame final e convidou os alunos a apanhá-la, usando apenas os instrumentos que pudessem fazer com uma caixa de sapatos de papelão contendo meio quilo de balas e alguns palitos.

        Quando não estava dando aula, Thorne freqüentemente depunha nos tribunais como especialista em processos legais que envolviam materiais de engenharia. Ele se especializou em explosões, acidentes de avião, desmoronamentos de prédios e outros desastres. Essas incursões no mundo real abriram seus olhos para o fato de que os cientistas deviam adquirir os mais variados conhecimentos. Costumava dizer: "Como podem desenhar plantas se não conhecem história e psicologia? Não podem, porque suas fórmulas matemáticas podem ser perfeitas, mas as pessoas vão usá-las de modo errado. E, quando isso acontece, significa que vocês erraram." Ele enriquecia suas aulas com citações de Platão, Chaka Zulu, Emerson e Chang-tsé.

        Porém, como professor popular entre os alunos — e que defendia a tese do ensino generalista —, Thorne percebeu que estava remando contra a maré. O mundo acadêmico marchava para uma especialização cada vez mais extrema, com terminologias cada vez mais densas e limitadas. Nesse ambiente, ser querido pelos alunos era uma leviandade. O interesse pelos problemas do mundo real era prova de pobreza intelectual e indiferença lamentável para com a teoria. Porém, no fim, foi sua admiração por Chang-tsé que o fez deixar a universidade. Numa reunião do departamento, um dos seus colegas levantou-se e disse que "Um chinês mítico e cretino significa tudo para a engenharia".

        Um mês depois, Thorne resolveu se aposentar antes do tempo e logo depois fundou sua empresa. Aquele trabalho era uma fonte de prazer real para ele, mas sentia falta do contato com os estudantes. Por isso gostou dos dois jovens assistentes de Levine. Os meninos eram inteligentes, cheios de entusiasmo e jovens demais para que a escola tivesse destruído toda a sua vontade de aprender. Podiam ainda usar os cérebros, o que, na opinião de Thorne, era um sinal certo de que não haviam concluído a educação formal.

       

        — Jerry! — berrou Thorne para um dos soldadores no RV. — Equilibre os reforços nos dois lados! Lembre-se dos testes de impacto! — Apontou para um monitor de vídeo no chão, que mostrava a imagem de computador do RV batendo numa barreira. Primeiro batia de frente, depois de lado, então girava e batia outra vez. Em todas as vezes o veículo sofria apenas pequenas avarias. O programa de computador fora feito pelos fabricantes de automóveis e depois descartado. Thorne o comprou e modificou. — É claro que os fabricantes de automóveis o rejeitaram: é uma boa idéia. Eles não querem nenhuma boa idéia saindo de uma grande empresa. Pode levar a um bom produto! — suspirou. — Usando este computador, já provocamos milhares de batidas com esses veículos, desenhando, batendo, modificando, batendo outra vez. Não teorias, apenas os testes reais. É assim que deve ser.

        

        O desprezo de Thorne pela teoria era lendário. Para ele, a teoria não passava de um substituto da experiência criado por alguém que não sabia de que estava falando.

        —  E agora, escute, Jerry? Jerry! Por que fazer todas essas simulações se vocês não seguem o projeto? Será que todo o mundo aqui perdeu o cérebro?

        — Desculpe, doutor...

        —  Não se desculpe! Faça a coisa certa!

        — Bem, de qualquer modo já temos reforço demais...

        — E mesmo? Foi o que você decidiu? Você agora é o desenhista do projeto? Apenas siga os planos!

        Caminhando ao lado de Thorne, Arby disse:

        — Estou preocupado com o Dr. Levine.

        — Está mesmo? Pois eu não estou.

        — Mas ele sempre foi confiável. E muito organizado.

        — Isso é verdade — concordou Thorne. — Também é completamente impulsivo e faz o que lhe dá na cabeça.

        —  Talvez — disse Arby —, mas não acredito que tenha desaparecido sem um bom motivo. Acho que pode estar em apuros. Na semana passada ele nos levou à Universidade de Berkeley para visitar o professor Malcolm, que tinha um mapa-múndi no escritório, que mostrava...

        — Malcolm! — bufou Thorne. — Por favor, essa não! Aqueles dois são igualzinhos. Cada um com menos espírito prático do que o outro. Mas acho bom eu tentar falar com Levine agora. — Deu meia-volta e caminhou para o escritório.

        Árby perguntou:

        — Vai usar o satfone? Thorne parou de andar.

         — Um o quê?    

        — O telefone-satélite — disse Arby. — O Dr. Levine não levou um com ele?

        — Como podia? Você sabia que o menor telefone-satélite é do tamanho de uma mala?

        — Eu sei, mas não precisa ser — disse Arby. — Você poderia ter feito um muito pequeno.

        — Eu poderia? Como? — Thorne parecia estar se divertindo. Era impossível não gostar daquele menino.

        —  Com aquela placa de computador VLSI que nós fomos buscar — disse Arby. — Aquela triangular. Tinha dois conjuntos de chips Motorola BSN-23, exclusivos da tecnologia criada pela CIA, porque permitem uma...

        — Ei, ei — Thorne interrompeu. — Onde você aprendeu tudo isso? Já avisei que não deve piratear sistemas...

        — Não se preocupe, eu tomo cuidado — disse Arby. — Mas é verdade o que eu disse sobre a placa de computador, não é? Pode ser usada para fazer um satfone de meio quilo. Então, você fez?

        Thorne olhou para ele por um longo tempo.

        — Talvez — disse, finalmente. — E daí? Arby disse com um largo sorriso:

        — Legal.   

                                                                               

        O pequeno escritório de Thorne ficava num canto do galpão. As paredes, internas eram cheias de plantas e esquemas de projetos, formulários de pedidos em pranchetas e recortes com desenhos de computador em três dimensões. Sobre a mesa espalhavam-se componentes eletrônicos, catálogos de equipamentos e pilhas de faxes. Thorne procurou no meio de tudo aquilo e finalmente encontrou um pequeno telefone cinzento.

        —  Aqui estamos. — Ergueu o aparelho, mostrando-o para Arby. — Muito bom, não é? Eu mesmo projetei.

        — Parece um telefone celular — disse Kelly.

        — Sim, mas não é. O telefone celular usa uma estação fixa. O telefone satélite conecta-se diretamente com os satélites de comunicação no espaço. Com um destes podemos falar com qualquer lugar do mundo. — Digitou os números rapidamente. — Antes eles precisavam de uma parabólica de um metro. Depois, de uma de trinta centímetros. Agora, não precisam de antena nenhuma, só do monofone. Nada mau, se posso dizer assim. Vamos ver se ele responde. — Apertou o botão do bocal. Ouviram o chamado no meio da estática.

        — Conhecendo Richard — disse Thorne —, provavelmente ele perdeu o avião ou esqueceu que precisava estar de volta hoje para os testes finais. E nosso trabalho está terminado. Chegamos aos reforços e aos bancos internos, e isso quer dizer que terminamos. Ele vai nos atrasar. É uma falta de consideração. — O telefone começou a tocar com bips contínuos. — Se não conseguir falar com ele, ligo para Sarah Harding.

        — Sarah Harding? — perguntou Kelly, erguendo os olhos para ele.

        — Quem é Sarah Harding? — perguntou Arby.

        — Apenas a mais famosa especialista do mundo em comportamento animal, Arb — disse Kelly.

        Sarah Harding era um dos ídolos de Kelly. Tinha lido tudo o que existia sobre ela. Sarah Harding começou como uma bolsista pobre na Universidade de Chicago, mas agora, com trinta e três anos, era professora assistente em Princeton. Era bonita e independente, uma rebelde que seguiu o próprio caminho. Escolheu a vida de cientista de campo e morava sozinha na África, onde estudava leões e hienas. E era famosa. Certa vez, quando seu Land Rover enguiçou, ela andou trinta quilômetros na savana, sozinha, defendendo-se dos leões com pedras.

        Nas fotos, Sarah sempre aparecia de short e camisa caqui, com binóculo pendurado no pescoço, ao lado do Land Rover. Com o cabelo escuro e curto e o corpo forte e musculoso, parecia sólida e charmosa ao mesmo tempo. Pelo menos era assim que Kelly a via, quando estudava as fotos atentamente, notando cada detalhe.

        — Nunca ouvi falar nela — disse Arby.

        — Tem passado muito tempo com os computadores, Arby?

        — Não — ele respondeu. Kelly o viu curvar os ombros para a frente como para se esconder, como fazia sempre que era criticado. Ele resmungou. — Especialista em comportamento animal?

        — Isso mesmo — disse Thorne. — Sei que Levine falou com ela várias vezes nas últimas semanas. Ela o está ajudando com todo esse equipamento, para quando for levado para o campo. Ou aconselhando. Ou coisa parecida. Ou talvez a conexão seja com Malcolm. Afinal, ela teve um caso com Malcolm.

        —  Eu não acredito — disse Kelly. — Talvez ele estivesse apaixonado por ela...

        Thorne olhou para Kelly.

        — Você a conhece?

        — Não. Mas sei tudo sobre ela.

        —  Sei. — Thorne não disse mais nada. Via os sinais da adoração por um herói e aprovava. Não havia nada de mal em admirar Sarah Harding. Afinal, uma menina podia idolatrar um atleta ou uma estrela do rock. Na verdade, era saudável para uma criança admirar alguém que realmente tentava contribuir para o avanço da ciência...

        O telefone continuou a tocar. Sem resposta.

        — Bem, sabemos que o equipamento de Levine está em ordem — disse Thorne — porque a ligação está sendo feita. Pelo menos disso nós sabemos.

        — Não pode localizar? — perguntou Arby.

        — Infelizmente, não. E, se continuarmos, podemos acabar com a bateria de campo, o que significa...

        Um estalo, e ouviram uma voz de homem, extremamente clara e distinta.

        — Levine.

        — Tudo bem. Ótimo. Ele está lá — disse Thorne. Apertou o botão no aparelho. — Richard? E Thorne.

        Ouviram o zumbido da estática, depois uma tosse e uma voz rouca disse.

        — Alô? Alô? Levine falando.

        Thorne apertou outro botão.                                         

        — Richard, é Thorne. Está me ouvindo?

        — Alô? Alô? — disse Levine. Thorne suspirou.

        —  Richard. Você tem de apertar o botão T para transmitir. Câmbio.

        — Alô? — Outra tosse, profunda e áspera. — Aqui é Levine. Alô?

        Thorne balançou a cabeça irritado.

        — Estou vendo que ele não sabe manejar o aparelho.Droga! Eu expliquei tudo tão bem! E claro que não estava prestando atenção. Os gênios nunca prestam atenção. Pensam que sabem tudo. Essas coisas não são brinquedos de criança. — Apertou o botão para transmitir. — Richard, escute. Deve apertar o "F para...

        — Aqui fala Levine. Alô? Levine. Por favor, preciso de ajuda. — Algo como um gemido surdo. — Se pode me ouvir, mande ajuda. Escute, estou na ilha, consegui chegar bem até aqui, mas...

        Um estalo. Um assobio.

        — Oh-oh — disse Thorne.

        — O que é? — perguntou Arby, inclinando-se para a frente.

        — Nós o estamos perdendo.

        — Por quê?

        —  Bateria — disse Thorne. — Está acabando rapidamente. Droga. Richard, onde você está?

        Ouviram a voz de Levine.

        —... já morto... situação ficou... agora... muito séria... não sei... pode me ouvir, mas se você... mande ajuda...

        — Richard! Diga onde você está!

        O telefone zumbiu, a transmissão ficava cada vez pior. Ouviram Levine dizer:

        — ... me cercaram, e... perigosos... sinto o cheiro deles especialmente... noite...

        — De que ele está falando? — perguntou Arby.

        — ...para... ferimento... não posso... muito tempo... por favor... E então ouviram o zumbido final, desaparecendo aos poucos. De repente, o telefone ficou mudo.

        Thorne desligou o aparelho e o alto-falante de mesa. Os dois meninos estavam pálidos.

        — Temos de encontrá-lo — disse Thorne — imediatamente.

       

      SEGUNDA  CONFIGURAÇÃO

     

        A auto-organização cresce em complexidade à medida que o sistema avança para o limite caótico.

        IAN MALCOLM

       

       AS PISTAS

        Thorne abriu com a chave a porta do apartamento de Levine e acendeu as luzes. Pararam atônitos, e Arby disse:

        — Parece um museu!

        O estilo da decoração do apartamento de dois quartos era levemente asiático, com belos armários de madeira e valiosos objetos antigos. Mas estava imaculadamente limpo e a maioria das antiguidades protegida por caixas de plástico. Tudo etiquetado. Entraram na sala.

        — Ele mora aqui? — perguntou Kelly. Não dava para acreditar. Parecia tão impessoal, quase inumano. O apartamento dela estava quase sempre em desordem...

        — E, mora, sim — disse Thorne, guardando a chave no bolso. — Está sempre assim. Por isso Levine não pode morar com uma mulher. Não admite que toquem nas coisas.

        Sobre a mesa de centro, rodeada pelos sofás, havia quatro pilhas de livros, cada uma coincidindo perfeitamente com a borda de vidro da mesa. Arby leu os títulos: Teoria da catástrofe e estruturas emergentes. Processos indutivos na evolução molecular. Autômata celular. Metodologia da adaptação não-linear, Transição de fase nos sistemas evolutivos. Havia outros com títulos em alemão.

        Kelly respirou fundo.

        — Tem alguma coisa cozinhando?

        —  Eu não sei — disse Thorne. Entrou na sala de jantar. No aparador encostado na parede ele viu uma chapa elétrica com uma fileira de pratos cobertos. A mesa de madeira polida estava posta para uma pessoa, com talheres de prata e copos de cristal lapidado. A fumaça saía de uma terrina com sopa.

        Thorne apanhou uma folha de papel que estava sobre a mesa e leu:

        —  Lagosta bisque, vegetais orgânicos, atum grelhado. — Anexa, uma folha amarela de bloco de recados dizia: "Espero que tenha feito boa viagem! Romelia."

        — Nossa —disse Kelly. —Vai me dizer que alguém faz o jantar para ele todos os dias?

        — Acho que sim — disse Thorne. Não parecia impressionado. Examinou a pilha de correspondência não-aberta ao lado do prato.

        Kelly apanhou alguns faxes na mesa ao lado. O primeiro era do Museu Peabody, em Yale, New Haven.

        — Isto é alemão? — ela perguntou, dando o fax para Thorne.

        Caro Dr. Levine:                                                      

        O documento que nos pediu:  

         Geschichtlich Forschungsarbeiten über die Geologie Zentralameriks, 1922-1929 foi enviado hoje pelo Federal Express.

        Obrigado.

        Dina Skrumbis, arquivista.

        — Não sei alemão — disse Thorne. — Mas acho que é alguma coisa sobre pesquisas em geologia da América Central. E é dos anos vinte, não exatamente uma novidade.

        — Para que será que ele queria isto? — disse Kelly. Thorne não respondeu e entrou num dos quartos.

       

        O quarto era simples e quase espartano, a cama um futon preto, perfeitamente arrumada. Thorne abriu as portas dos closets e viu as fileiras de cabides, dispostos em espaços regulares, toda a roupa passada, grande parte protegida por capas de plástico. Abriu a primeira gaveta da cômoda e viu as meias dobradas, arrumadas por cores.

        — Não sei como ele pode viver assim — disse Kelly.

        — Não tem mistério — disse Thorne. — Basta ter empregados. — Abriu as outras gavetas rapidamente, uma depois da outra.

        Kelly foi até a mesa-de-cabeceira, onde havia vários livros. O de cima era pequeno e amarelado pelo tempo. Era em alemão: Die Fünf Todesarten. Ela folheou rapidamente, viu as gravuras coloridas do que pareciam ser trajes astecas de cores vivas. Era quase como um livro infantil ilustrado, pensou.

        Debaixo dele estavam livros e artigos de revistas especializadas com a capa escura do Instituto Santa Fé: Algoritmos genéticos e redes heurísticas. Geologia da América Central, Disposição autômata da dimensão arbitrária. O Relatório Anual de 1989 da empresa InGen. E ao lado do telefone uma folha com anotações escritas às pressas. Ela reconheceu a letra clara de Levine.

        Dizia

        "SÍTIO B"

        Vulkaniche

        Tacaho?

        Nublar?

        1 de 5 mortes?

        nas monta... Não!!

        talvez Guitierrez

        cuidado.  

                                                                       

        Kelly perguntou.

        — O que é Sítio B? Ele tem umas anotações aqui sobre isso. Thorne foi verificar.

        —  Vulkanische quer dizer vulcânico, eu acho. E Tacano e Nublar... Parecem nomes de lugares. Se forem, podemos verificar num Atlas...

        — E o que é isto sobre cinco mortes? — ela perguntou.

        — Não tenho idéia.

        Estavam olhando para o papel quando Arby entrou no quarto e perguntou:

        —  O que é Sítio B?                          

        Thorne virou para ele.

        — Por quê?

        — Acho melhor vir ver uma coisa no escritório dele.

        Levine tinha feito o escritório no segundo quarto. Como o resto do apartamento, estava impecavelmente limpo e em ordem. Os papéis estavam arrumados com precisão num lado da mesa, perto do computador coberto com uma capa de plástico. Mas, atrás da mesa, um quadro de cortiça cobria quase toda a parede. E nesse quadro Levine tinha pregado mapas, cartas, recortes de jornais, imagens de satélite e fotografias aéreas. Na parte superior do quadro uma anotação em letras grandes: "Sítio B?"

        Ao lado estava uma foto pouco nítida de um chinês de óculos com um jaleco branco de laboratório, na selva, perto de uma tabuleta de madeira que dizia: "Sítio B". O jaleco estava desabotoado, mostrando a camiseta com alguma coisa escrita.

        Ao lado da foto estava uma grande ampliação da camiseta, como aparecia na fotografia original. Quase não dava para ver as letras, parcialmente escondidas pelos dois lados do jaleco, mas a camiseta parecia dizer:

        nGen Sítio B

        mplexo pesqui

        Levine tinha escrito à mão com letra clara: "InGen Sítio B Complexo de pesquisa??? ONDE???

        Logo abaixo viram uma passagem recortada do Relatório Anual da InGen. Um parágrafo dentro de um círculo dizia:

       

         Além da sua sede em Paio Alto, onde a InGen mantém um laboratório de pesquisas ultramoderno com 600 metros quadrados, a empresa possui três laboratórios de campo no resto do mundo. Um laboratório de geologia na África do Sul, onde são coletados âmbar e outros espécimes geológicos; uma fazenda experimental nas montanhas da Costa Rica, onde são cultivadas variedades de plantas exóticas, e um complexo na ilha Nublar, duzentos quilômetros a oeste da Costa Rica.

       

        Logo abaixo, Levine escreveu: "Não B! Mentirosos!"

        — Ele está mesmo obcecado por esse Sítio B. — disse Arby.

        — Tem razão — disse Thorne. — E ele acha que fica numa ilha em algum lugar.

        Thorne se aproximou mais do mapa, examinando as imagens de satélite. Notou que, embora estivessem gravadas com cores falsas, com vários graus de ampliação, todas pareciam mostrar a mesma área geográfica, de um modo geral: uma costa rochosa com algumas ilhas ao largo. A linha da costa tinha uma praia cercada pela selva. Podia ser da Costa Rica, mas era impossível dizer ao certo. Na verdade, podia ser uma dezena de lugares do mundo.

        — Ele disse que estava numa ilha — observou Kelly.

        — Sim. — Thorne deu de ombros. — Mas isso não ajuda muito. — Olhou outra vez para o quadro. — Deve haver vinte ilhas aqui, talvez mais.

        Viu um memorando na parte inferior do quadro.

       

SÍTIO B@#$#PARATODOS OS DEPARTAMENTOS DEQ ****         AOS CUIDADOS DE%$#@#!PRESS AVOIDAN******

Sr. Hammond quer lembrar a todos ****depois/v*&Amercado *%*** Plano de mercado a longo prazo*&A&A%

Mercado dos complexos propostos exige que a completa complexidade da tecnologia de JP não seja revelada anunciada seja conhecida. O Sr. Hammond quer lembrar a todos os departamentos que o complexo de Produção não será tópico assunto de qualquer informação à imprensa ou discussão em qualquer tempo.

O complexo de produção/fabricação não pode ser#@#$# referência ao local da ilha de produção Islã S. apenas referência interna estritas diretrizes de imprensa ****%$**

 

        — Isto é estranho — disse ele. — O que vocês acham?

        Arby olhou pensativamente para o memorando.

        — Todas as letras que faltam são lixo — disse Thorne. — Faz algum sentido para você?

        —  Faz — disse Arby. Estalou os dedos e foi para a mesa de Levine. Tirou a capa de plástico do computador e disse: — Foi o que pensei.

        O computador na mesa de Levine não era tão moderno como Thorne teria esperado. Era grande e pesado, com a parte externa arranhada em vários lugares. Uma fita adesiva preta dizia: "Design Associates, Inc." E mais abaixo, ao lado do botão de força, uma pequena placa de metal dizia: "Propriedade da International Genetics Technology, Inc., Paio Alto, CA."

        —  O que é isso? — perguntou Thorne. — Levine tem um computador da InGen?

        —  Sim — disse Arby. — Apanhamos para ele na semana passada. Estavam vendendo equipamento para computador.

        — E ele mandou vocês?

        —  Isso mesmo. Eu e Kelly. Ele não. queria ir pessoalmente. Tem medo de estar sendo seguido.

        — Mas esta coisa é um CAD-CAM e deve ter uns cinco anos — disse Thorne. — Os computadores CAD-CAM eram usados por arquitetos, artistas gráficos e engenheiros mecânicos. Para que Levine ia querer isso?

        — Ele não disse. — Arby ligou o computador. — Mas agora eu sei.

        — Sabe?

        —  Aquele memorando. — Arby indicou o quadro com a cabeça. — Sabe por que está daquele jeito? E um arquivo de computador recuperado. Levine está recuperando os arquivos da InGen desta máquina.

       

        Como Arby explicou, todos os computadores vendidos pela InGen naquele dia tinham os drives reformatados para destruir qualquer dado sensível dos discos. Mas os computadores CAD-CAM eram uma exceção. Todos tinham um software especial instalado pelo fabricante. O software era projetado para funcionar com computadores individuais, usando códigos de referência individuais. Isso fazia com que fosse difícil reformatar, porque teriam de reinstalar o software individualmente e isso levaria horas.

        — Então, eles não reformataram — disse Thorne.

        — Certo — concordou Arby. — Apenas apagaram o diretório e venderam os computadores.

        —  Isso quer dizer que os arquivos originais estão ainda no disco.

        —  Certo.

        O monitor acendeu. A tela dizia:

        ARQUIVOS TOTALMENTE RECUPERADOS: 2.387.

        —  Nossa! — Arby inclinou-se para a frente olhando com atenção, os dedos nas teclas. Digitou a tecla para diretório e fileira após fileira de nomes de arquivos passaram na tela. Milhares de . arquivos ao todo.

        Thorne perguntou.

        —  Como você vai...

        — Me dê um minuto — interrompeu Arby, e começou a digitar rapidamente.

        —  Tudo bem, Arby — disse Thorne. Ele achava graça na atitude imperiosa de Arby sempre que usava um computador. Parecia esquecer que era apenas um menino e toda a sua timidez desaparecia. O mundo eletrônico era seu elemento. E Arby sabia que era muito bom nisso.

        Thorne disse:

        —  Qualquer ajuda que possa nos dar será...

        — Dr. Thorne — disse Arby. — Escute. Vá... bem, eu não sei. Vá ajudar Kelly, ou coisa assim.

        E voltou para o teclado.

       

       RAPTOR

        O velocirraptor tinha um metro e oitenta e cinco de altura e era verde-escuro. Em posição de ataque, ele emitia um silvo estridente, o pescoço musculoso estendido para a frente, a boca aberta. Tim, um dos modeladores, disse:

        — O que acha, Dr. Malcolm?

        — Não é uma ameaça — disse Malcolm. Estava passando por uma das alas do departamento de biologia, a caminho do seu escritório.

        — Não é uma ameaça? — perguntou Tim.

        — Ele nunca fica nessa posição, apoiado nos dois pés. Dê um livro para ele — apanhou um caderno de anotações da mesa e pôs nos braços do animal — e ele poderia cantar uma canção de Natal.

        — Puxa — disse Tim. — Não pensei que estivesse tão ruim.

        — Ruim? — disse Malcolm — Isto é um insulto a um grande predador. Devíamos sentir sua velocidade, ameaça e força. Abra mais as mandíbulas. Abaixe o pescoço. Enrijeça os músculos, estique a pele. E levante esta perna. Lembre, os raptores não atacam com a boca — eles usam as garras dos pés. Quero ver aquela garra levantada, pronta para descer e rasgar os intestinos da presa.

        —  Acha mesmo? — Tim não parecia muito convencido. — Pode assustar as crianças...

        — Quer dizer, pode assustar você. — Malcolm continuou seu caminho. — E outra coisa: mude esse som sibilante. Parece alguém urinando. Dê um rosnado para o animal. Dê ao grande predador aquilo a que ele tem direito.

        — Nossa — disse Tim. — Eu não sabia que tinha sentimentos tão pessoais em relação a isso.

        — Deve ser exato — disse Malcolm. — Você sabe, existe uma coisa chamada exatidão e outra chamada inexatidão. Independente de quais sejam os seus sentimentos — continuou a andar, irritado, ignorando a dor na perna. O modelador o aborrecia, embora tivesse de admitir que Tim era apenas um representante da corrente de pensamento confuso — o que Malcolm chamava de "ciência sentimentalóide".

        Há muito tempo Malcolm se impacientava com a arrogância dos seus colegas cientistas. Eles mantinham aquela arrogância, ele sabia, ignorando definitivamente a história da ciência como uma forma de pensamento. Os cientistas diziam que a história não tinha importância porque os erros do passado estavam sendo corrigidos pelas descobertas modernas. Mas é claro que seus antepassados também pensavam assim. Estavam errados no seu tempo. E os cientistas modernos estavam errados agora. Nenhum episódio da história da ciência comprovava isso de modo mais claro do que o modo pelo qual os dinossauros tinham sido representados através das décadas.

        Era importante saber que a percepção mais exata dos dinossauros foi a primeira. Na década de 1840, quando Richard Owen descreveu pela primeira vez ossos gigantes na Inglaterra, ele os chamou de Dinosauria: lagartos terríveis. Esta era ainda a mais exata definição dessas criaturas, pensava Malcolm. Eram realmente como lagartos e eram terríveis.

        Mas, depois de Owen, a visão "científica" sobre os dinossauros sofreu várias mudanças. Porque os vitorianos acreditavam na inevitabilidade do progresso, insistiam em dizer que os dinossauros deviam ser necessariamente inferiores — do contrário, por que estavam extintos? Assim os vitorianos os fizeram gordos, letárgicos e burros — grandes idiotas do passado. Essa percepção foi elaborada de tal modo que no começo do século XX os dinossauros tornaram-se tão fracos que mal podiam suportar o próprio peso. Os apatossauros tinham de ficar o tempo todo com a barriga mergulhada na água para não amassar as próprias pernas. Toda a concepção do mundo antigo sofre a influência dessas idéias acerca de animais fracos, burros e lerdos.

    

   Essa descrição só foi mudada na década de 1960, quando alguns cientistas renegados, liderados por John Ostrom, começaram a imaginar dinossauros ágeis, rápidos, de sangue quente. Como esses cientistas tiveram a ousadia de questionar o dogma, foram brutalmente criticados durante anos, muito embora tudo parecesse indicar que sua idéia estava certa.

        Porém, na última década, um maior interesse pelo comportamento social levou a outra concepção. Os dinossauros passaram a ser vistos como criaturas amorosas, que viviam em grupos e criavam seus filhotes. Eram bons animais, até mesmo engraçadinhos. Os grandes e doces animais nada tinham a ver com o destino terrível que os acometeu na forma do meteoro de Alvarez. E essa nova concepção sentimentalóide produziu gente como Tim, que não queria ver a outra face da vida. É claro que alguns dinossauros eram sociais e cooperativos. Mas outros eram caçadores — e matadores de uma crueldade sem igual. Para Malcolm, o verdadeiro quadro da vida no passado incorporava a interação de todos os aspectos da vida, o bom e o mau, o forte e o fraco. Não adiantava pretender qualquer outra coisa.

        Assustar as crianças, essa era muito boa! Andando no corredor, Malcolm bufou, irritado.

        Na verdade, Malcolm estava preocupado com o que Elizabeth Gelman havia dito sobre o fragmento de tecido e especialmente sobre a etiqueta. Malcolm tinha certeza de que a etiqueta ia causar problemas.

        Mas não sabia o que fazer a respeito.

        Virou na esquina, passou por uma exposição de flechas feitas pelos homens primitivos da América. Na ante-sala do seu escritório, Beverly, sua assistente, arrumava os papéis sobre a mesa, preparando-se para ir para casa. Entregou a ele os faxes do dia e disse:

        — Deixei uma mensagem para o Dr. Levine no escritório dele, mas ele não telefonou. Ao que parece, não sabem onde ele está.

        — Para variar. — Malcolm suspirou. Era difícil trabalhar com Levine, ele era imprevisível demais, nunca se podia saber o que esperar. Foi Malcolm quem pagou a fiança quando Levine foi detido na sua Ferrari. Examinou os faxes. Datas de conferências, pedidos de cópias... nada interessante. — Tudo bem, Beverly, obrigado.

        — Ah. Os fotógrafos estiveram aqui. Eles terminaram há uma hora mais ou menos.                                                              

        — Que fotógrafos?

        — Do Chãos Quarterly. Vieram fotografar seu escritório.

        — Do que você está falando? — perguntou Malcolm.

        — Eles vieram fotografar seu escritório — ela repetiu. — Para uma série sobre os locais de trabalho de matemáticos famosos. Tinham uma carta sua, dizendo que era...

        — Eu não escrevi carta nenhuma — disse Malcolm. — E nunca ouvi falar de Chãos Quarterly.

        Malcolm entrou no escritório e olhou em volta. Beverly foi atrás dele, preocupada.

        — Está em ordem? Está tudo aí?

        — Sim — disse ele, fazendo um exame rápido. — Parece que está em ordem. Começou a abrir as gavetas da mesa. Não parecia faltar nada.

        — E um alívio — disse Beverly — porque... Malcolm olhou para a outra extremidade da sala. O mapa.

        Malcolm tinha um mapa-múndi com alfinetes marcando todos os lugares em que haviam aparecido o que Levine insistia em chamar de "formas aberrantes". Numa estimativa otimista — a de Levine —, eram doze ao todo, de Rangiroa, no oeste, até o sul da Califórnia e o Equador, no leste. Poucas eram confirmadas. Mas agora havia a amostra de tecido que confirmava um espécime, o que fazia as outras parecerem mais plausíveis.

        — Eles fotografaram este mapa?

        — Sim. Fotografaram tudo. Tem importância?

        Malcolm olhou para o mapa, tentando ver com os olhos de um estranho, imaginando se seria fácil interpretar aquelas marcas. Ele e Levine haviam passado horas na frente do mapa, considerando as possibilidades de um "mundo perdido", tentando descobrir onde elo poderia estar. Tinham limitado a área possível a cinco ilhas de uma série, ao largo do litoral da Costa Rica. Levine estava convencido de que era uma daquelas cinco ilhas, e Malcolm começava a pensar que ele estava certo. Mas aquelas ilhas não estavam destacadas no mapa...

        —  Era um grupo muito amável — disse Beverly.— Muito delicado. Estrangeiros... Suíços, eu acho.

        Malcolm balançou a cabeça e suspirou. Para o diabo com tudo aquilo, pensou ele. Mais cedo ou mais tarde alguém ia saber.

        — Está tudo bem, Beverly.

        — Tem certeza?                                                                 

        — Sim, está tudo bem. Tenha uma boa noite.                    

        — Boa noite, Dr. Malcolm.

        Sozinho no escritório, ele ligou para Levine. O telefone tocou, e a secretária eletrônica atendeu. Levine ainda não estava em casa.

        —  Richard, você está aí? Se estiver, atenda, é importante. Esperou. Não aconteceu nada.

        — Richard, é o Ian. Escute, temos um problema. O mapa já não é seguro. Mandei analisar aquela amostra, Richard, e acho que ela nos diz onde fica o Sítio B, se a minha...

        Um clique e alguém apanhou o fone. Malcolm ouviu a respiração no outro lado da linha.

        — Richard? — perguntou.

        — Não — disse a voz. — Aqui é Thorne. E acho melhor você vir para cá imediatamente.

       

       AS CINCO MORTES

        — Eu sabia — Malcolm disse, quando chegou ao apartamento de Levine e olhou rapidamente em volta. — Eu sabia que ele ia fazer alguma coisa desse tipo. Você sabe como Levine é impetuoso. Eu disse a ele, não vá antes de termos toda a informação. Mas eu devia saber. É claro que ele foi.

        — Sim, ele foi.

        — Ego — Malcolm disse, balançando a cabeça. — Richard tem de ser o primeiro. Tem de descobrir primeiro, tem de chegar primeiro. Estou muito preocupado, ele pode estragar tudo. Esse comportamento impulsivo, você sabe, é uma tempestade no cérebro, neurônios no limite do caos. A obsessão não passa de uma variação do vício. Mas qual o cientista que já teve autocontrole? Eles aprendem isso na escola, não é bonito ser equilibrado. Esquecem que Neils Bohr não foi só um grande físico, mas também um atleta olímpico. Hoje em dia todos eles tentam ser "obsessivos". É o estilo profissional.

        Thorne olhou pensativamente para Malcolm, pensando que talvez estivesse percebendo uma ponta de ressentimento competitivo.

        — Você sabe para que ilha ele foi? — perguntou.

        —  Não, eu não sei. — Malcolm andava pelo apartamento, examinando tudo. — Na última vez em que conversamos, limitamos as possibilidades a cinco ilhas, todas no sul. Mas não tínhamos resolvido ainda qual delas.

        Thorne apontou para as imagens do satélite no quadro de cortiça.  

        — Estas ilhas aqui?

        —  Sim — disse Malcolm, olhando rapidamente. — Elas formam um arco, todas a cerca de dezesseis quilômetros da costa, na altura da baía de Puerto Cortês. São supostamente desertas. O povo local as chama de as Cinco Mortes.

        — Por quê? — perguntou Kelly.

        — Uma antiga lenda indígena — disse Malcolm. — Algo sobre um bravo guerreiro capturado por um rei que ofereceu a ele a escolha entre cinco tipos de morte. Ser queimado, afogado, amassado, enforcado, decapitado. O guerreiro disse que ficava com todas e foi de ilha em ilha, experimentando os vários desafios. Uma espécie de versão do Novo Mundo das vicissitudes de Hércules.

        — Então é isso! — disse Kelly, e saiu correndo da sala. Malcolm não entendeu.

        Virou para Thorne, que deu de ombros. Kelly voltou com o volume que parecia um livro infantil em alemão e o entregou para Malcolm.

        — Sim — disse ele. — Die Fünf Todesarten. As cinco formas da Morte. É interessante que seja em alemão...

        — Ele tem uma porção de livros em alemão — disse Kelly.           — Tem mesmo? O filho da mãe. Ele nunca me disse.

        — Significa alguma coisa? — perguntou Kelly.

        — Significa muita coisa. Dê-me aquela lente de aumento, por favor.                                                                                   

        Kelly apanhou a lente da mesa e entregou a ele.                 

        —  O que significa?

        — As Cinco Mortes são antigas ilhas vulcânicas — disse

        Malcolm. — O que quer dizer que são geologicamente muito ricas. Na década de 1920, os alemães queriam explorar a mineração nas ilhas. — Examinou as imagens com a lente. — Ah, sim, essas são as ilhas, não há dúvida. Matanceros, Muerte, Tacano, Sorna, Pena... Todos nomes de morte e destruição... Muito bem. Acho que estamos perto. Temos alguma imagem de satélite com análise espectográfica da camada de nuvem?

        — Isso vai nos ajudar a encontrar o Sítio B?

        — O quê? — Malcolm girou o corpo rapidamente e olhou para ele. — O que você sabe sobre o Sítio B?                         

       

        Arby estava sentado na frente do computador, trabalhando ainda.

        — Nada. Apenas que o Dr. Levine estava procurando o Sítio B. E era o nome que estava nos arquivos.

        — Que arquivos?

        — Eu descobri alguns arquivos da InGen neste computador. E procurando entre os antigos registros, encontrei referências ao Sítio B... Mas são bastante confusas. Como esta. — Inclinou para trás na cadeira para que Malcolm pudesse ver a tela.  

       

        Resumo: Revisões do Plano #35

        PRODUÇÃO                                          (SÍTIO B)

        OPERADORES DE AR                      Grau 5 a Grau 7

        ESTRUTURA DO LAB.                      400cm a 510cm

        BIOSSEGURANÇA                           Nível PK/3 a Nível PK/5

        VELOCIDADE DA CORREIA                                                      

        TRANSPORTADORA                        3 mpm a 2,5 mpm                      

        JAULAS                                          13 hectares 26 a hectares     

        EQUIPE Q                                       17(4 admi) a 19 (4admi) 

        PROTOCOLO COM                          ET(VX) a RDT(VX)  

       

        Malcolm franziu a testa.

        — Curioso, mas não ajuda muito. Não nos diz qual é a ilha, nem mesmo se é uma ilha.

        — Bem — Arby digitou algumas teclas. — Vejamos. Olhe isto.

       

SÍTIO B REDE DA ILHA                            PONTOS NODAIS

ZONA 1 (RIO)                                                      1 - 8

ZONA 2 (COSTA)                                                 9 -16

ZONA 3 (CORDILHEIRA)                                    17 - 24      

            ZONA 4 (VALE)                                                     25 - 32     

       

        — Tudo bem, então é uma ilha. E o Sítio B tem uma rede, mas uma rede de quê? Computadores? — perguntou Malcolm.

        — Eu não sei. Talvez de rádio — respondeu Arby.      

        — Para quê? Qual a utilidade de uma rede de rádio? Isto não ajuda muito.

        Arby deu de ombros, tomando aquilo como um desafio. Começou a digitar furiosamente outra vez. Então disse:

        —  Espere!... Aqui está outro... se eu conseguir formatar... Pronto! Consegui!

        Afastou-se da tela para que os outros pudessem ver. Malcolm olhou e disse.

        — Muito bom. Muito bom!

       

SÍTIO B — LEGENDAS

ALA LESTE                               ALA OESTE                    ÁREA DE CARGA

LABORATÓRIO                     ÁREA DE MONTAGEM                ENTRADA

PLANO GERAL                      ÁREA CENTRAL                          GEOTURBINA

LOJA DE CONVENIÊNCIA     VILA DOS TRABALHADORES     GEOCENTRO

POSTO DE GASOLINA           PISCINA/TÊNIS                          CAMPO DE GOLFE

CASA DO ADMINISTRADOR  PISTA DE CORRIDA                   TUBULAÇÃO DE GÁS

SEGURANÇA UM                  SEGURANÇA DOIS                CONDUTORES TÉRMICOS

DOCA FLUVIAL                     CASA DE BARCOS                      SOLAR UM

ESTRADA DO PÂNTANO       ESTRADA DO RIO              ESTRADA DA CORDILHEIRA

ESTRADA DA MONTANHA    ESTRADA DO PENHASCO           JAULAS

 

        — Agora estamos chegando a algum lugar — disse Malcolm, examinando a lista. — Pode imprimir isto?

        — Claro — disse Arby, com um sorriso satisfeito. — É mesmo bom?

        — É mesmo bom — disse Malcolm. Kelly olhou para Arby e disse:

        — Arb, estas são as legendas do mapa.

        — Sim, acho que sim. Legal, não é mesmo? — Apertou a tecla para imprimir.

        Malcolm examinou a lista outra vez, depois voltou para os mapas do satélite, olhando atentamente para cada um com a lente de aumento e o nariz a poucos centímetros das fotos.

        — Arb — disse Kelly —, não fique aí sentado. Vamos! Recupere o mapa! É o que precisamos!

        — Não sei se posso — disse Arby. — É um formato que implica trinta e dois bits... Quero dizer, é um grande trabalho.

        — Pare de choramingar, Arb, e faça.

        —  Não precisa — disse Malcolm, afastando-se das fotos de satélite. — Não é importante.

        — Não é? — perguntou Arby, um pouco ofendido.

        — Não, Arby. Pode parar. Porque, com o que já descobrimos, tenho certeza de que posso identificar a ilha agora mesmo.

       

       JAMES

        Ed James bocejou e apertou mais o fone contra a orelha. Queria ter certeza de ouvir tudo. Procurou uma posição mais confortável no banco do seu Taurus cinzento, tentando ao mesmo tempo continuar acordado. O pequeno gravador girava no seu colo, ao lado do bloco de anotações e das embalagens amassadas de dois Big Macs. James olhou para o prédio de Levine, no outro lado da rua. As luzes estavam acesas no apartamento do terceiro andar.

        E o grampo que ele havia instalado estava funcionando com perfeição. Ouviu um dos meninos dizer:

        —  Como?

        E então o cara aleijado, Malcolm, disse:

        — A essência da verificação é a convergência das várias linhas de raciocínio para um mesmo ponto.

        —  O que quer dizer isso? — perguntou o menino.

        — Veja essas fotos do Landsat.

        James escreveu LANDSAT no bloco de anotações.

        — Já olhamos para elas — disse a menina.

        James pensou na tolice de não ter percebido antes que os dois meninos estavam trabalhando para Levine. Lembrava bem deles. Estavam na classe em que Levine lecionava. Um garoto pequeno e negro e uma menina branca desajeitada. Apenas crianças de onze ou doze anos. Ele devia ter adivinhado.

        Não que fosse importante agora, pensou. Estava conseguindo a informação. Estendeu a mão para a parte superior do painel, apanhou as últimas duas batatas fritas e comeu, embora estivessem frias.

        —  Tudo bem — ouviu Malcolm dizer, — É esta ilha aqui. Levine foi para esta ilha.

        A menina parecia duvidar.                                         

        — Acha mesmo? Esta é... a Islã Sorna.                           

         James escreveu ISLÃ SORNA.

        —  Esta é a nossa ilha — disse Malcolm. — Por quê? Três motivos diferentes. O primeiro, é uma ilha particular, portanto não foi completamente revistada pelo governo da Costa Rica. Segundo, a quem pertence? Aos alemães, que nos anos vinte conseguiram o leasing da ilha para mineração.

        — Todos aqueles livros em alemão?

        — Exatamente. Terceiro, pelo que vimos na lista de Arby, e em outra fonte independente, está claro que existe gás vulcânico no Sítio B. Assim, qual a ilha que tem gás vulcânico? Apanhe a lente de aumento e verifique você mesma. Acontece que só uma ilha tem esse tipo de gás.

        — Quer dizer esta aqui? — perguntou a menina.

        — Certo. Isso é fumaça vulcânica.

        — Como sabe?

        —  Análise espectrográfica. Está vendo esta coluna aqui? E enxofre na camada de nuvem. Na verdade, as únicas fontes de enxofre são as fontes vulcânicas.

        — Isso também é vulcânico? — perguntou Thorne.

        —  Pode ser. A atividade vulcânica desprende metano, mas geralmente durante as erupções. A outra possibilidade é ser material orgânico.

        —  Orgânico? O que quer dizer?

        — Grandes herbívoros e...

        Depois eles disseram alguma coisa que James não ouviu e em seguida ouviu a voz do menino.

        — Quer que eu termine esta recuperação ou não? — Ele parecia aborrecido.

        — Não — disse Thorne. — Pode deixar, Arby. Sabemos o que lemos de fazer. Vamos, meninos!

        James olhou para o apartamento e viu as luzes serem apagadas. Alguns minutos depois, Thorne e os meninos apareceram na porta em frente do prédio. Entraram no jipe e foram embora. Malcolm foi para seu carro, entrou com alguma dificuldade e saiu na direção oposta.

        James pensou em seguir Malcolm, mas tinha outra coisa a fazer. Ligou o motor, apanhou o telefone e discou um número.

       

       SISTEMAS DE CAMPO

        Meia hora mais tarde, outra vez no escritório de Thorne, Kelly olhou em volta, atônita. Quase todos os trabalhadores já haviam saído, e o galpão estava limpo e em ordem. Os dois trailers e o Explorer estavam lado a lado, pintados de verde-escuro e prontos para partir.

        — Eles terminaram!

        — Eu disse que iam terminar — disse Thorne. Voltou-se para seu capataz, Eddie Carr, um jovem forte de vinte e poucos anos. — Eddie, onde estamos?

        —  Prontos para a viagem, Thorne — Eddie disse. — A tinta ainda não secou em alguns lugares, mas estará seca de manhã.

        — Não podemos esperar até amanhã. Vamos partir agora.

        — Vamos?

        Arby e Kelly trocaram um olhar. Era novidade para eles, também.

        —  Preciso de você para dirigir um destes, Eddie — disse Thorne — Precisamos estar no aeroporto à meia-noite.

        — Mas pensei que fôssemos fazer os testes de campo...

        —  Não há tempo para isso. Vamos direto para o local. — Tocaram a campainha. — Provavelmente é Malcolm. — Apertou o botão para abrir a porta.

        —  Não vai fazer o teste de campo? — perguntou Eddie, preocupado. — Acho melhor verificar o funcionamento deles, Thorne. Fizemos algumas modificações bastante complexas e...

        — Não temos tempo — disse Malcolm, entrando. — Temos de partir imediatamente. — Voltou-se para Thorne. — Estou muito preocupado com ele.     

        Eddie, os documentos já chegaram? — perguntou Thorne.

        — Ah, claro, estão aqui desde a semana passada.

        — Muito bem, vá apanhá-los e telefone para Jenkins. Diga que nos encontre no aeroporto e trate dos detalhes. Quero partir dentro de quatro horas.

        — Nossa, Thorne...

        — Faça o que eu disse.

        — Vocês vão à Costa Rica? — perguntou Kelly.

        — Isso mesmo. Temos de tirar Levine de lá. Se não for tarde demais.

        — Nós vamos também — disse Kelly.

        — Isso mesmo — disse Arby. — Nós vamos.

        — De jeito nenhum — disse Thorne. — Fora de cogitação.

        — Mas nós merecemos!

        — O Dr. Levine falou com nossos pais!

        — Já temos permissão!

        — Vocês têm permissão — Thorne disse severamente — para um teste de campo no bosque a duzentos quilômetros daqui. Mas não é para lá que nós vamos. Vamos a um lugar que pode ser muito perigoso e vocês não vão conosco. Ponto final.

        — Mas...

        — Meninos — disse Thorne. — Não me façam perder a paciência. Vou dar um telefonema. Apanhem suas coisas. Vocês vão para casa.

        Ele deu as costas e foi para o telefone.                      

        — Puxa — disse Kelly.

            Arby mostrou a língua para as costas de Thorne e resmungou:

        — Grande babaca.

        — Continue com o programa, Arby — Thorne disse, sem olhar para trás. — Vocês dois vão para casa. Sem discussão.

        Entrou no escritório e bateu a porta. Arby enfiou as mãos nos bolsos.

        — Eles não teriam descoberto nada sem a nossa ajuda.

        — Eu sei, Arb — disse Kelly. — Mas não podemos obrigá-los a nos levar.

        Voltaram-se para Malcolm.

        — Dr. Malcolm, poderia por favor...

        — Desculpe — disse Malcolm. — Não posso.

        — Mas...

        — A resposta é não, garotos. É perigoso demais.

        Desapontados, eles caminharam lentamente para os veículos que brilhavam, refletindo a luz do teto. O Explorer com os painéis fotovoltaicos escuros na capota e no capo, o interior repleto de equipamento eletrônico novo em folha. Só de olhar para o Explorer dava uma sensação de aventura — uma aventura na qual não tomariam parte.

        Arby espiou para dentro do trailer maior, encostando o rosto no vidro e protegendo os olhos com as mãos em concha nos lados do rosto.

        —  Caramba! Veja isto!

        —  Eu vou entrar — Kelly disse, abrindo a porta, por um momento surpresa com a solidez e o peso do metal. Então ela subiu os degraus para o trailer.

        O interior era cinza e repleto de equipamento eletrônico. Era dividido em duas seções para as diferentes funções do laboratório. A área principal era um laboratório de biologia, com bandejas para espécimes, placas para dissecação e microscópios ligados a monitores de vídeo. O laboratório incluía também equipamento bioquímico, espectrômetro e uma série de analisadores de amostras automatizados. Ao lado ficava a ampla seção do computador, um banco de processadores e uma seção de comunicações. Todo o equipamento do laboratório era miniaturizado e embutido em pequenas mesas que deslizavam para dentro da parede e podiam ser fechadas a chave.

        — É demais — disse Arby.

        Kelly não respondeu. Examinava atentamente o laboratório. O doutor Levine tinha projetado aquele trailer aparentemente com um objetivo específico. Não havia espaço para geologia, botânica ou química, nem muitas outras coisas que uma equipe de campo devia estudar. Não era um laboratório científico geral. Na verdade, parecia mais uma unidade de biologia e uma grande unidade de computador.

        Biologia e computadores.   

        Ponto final.

        Aquele trailer fora construído para estudar o quê?

        Numa das paredes havia uma pequena estante de livros, os livros presos com uma fita de Velcro. Ela leu os títulos: Modelos de adaptação dos sistemas biológicos, Dinâmica comportamental dos vertebrados, Adaptação de sistemas naturais e artificiais, Dinossauros da América do Norte, pré-adaptação e evolução... Parecia uma coleção estranha para levar numa expedição na selva. Se havia alguma lógica, ela não via.

        Continuou a inspeção. Nas paredes notavam-se a intervalos os reforços adaptados ao trailer; listras escuras de composto de carbono. Thorne tinha dito que era o material usado nos aviões supersônicos de combate. Muito leve e muito resistente. Notou também que os vidros das janelas eram todos de material especial com uma fina grade de arame por dentro.

        Por que o trailer era tão reforçado?

        Era um pouco inquietante e Kelly lembrou as palavras do Dr. Levine no telefone. Ele disse que estava cercado.

        Cercado de quê?

        Ele tinha dito: Sinto o cheiro deles, especialmente à noite.

        A que estava se referindo?

        Quem eram eles?

        Ainda preocupada, Kelly foi para a parte de trás do trailer, onde ficava a pequena área social, com cortinas de algodão nas janelas. Cozinha compacta, um banheiro e quatro camas. Compartimentos para guardados acima e debaixo das camas. Tinha até um chuveiro. Era bonito.

        Kelly entrou na passagem sanfonada que ligava os dois trailers. Era mais ou menos como a passagem entre dois vagões de trem, muito curta. Entrou no segundo trailer, que parecia servir mais para armazenagem de material. Pneus sobressalentes, autopeças, mais equipamento de laboratório, prateleiras e armários. Todo o suprimento que indicava uma expedição a algum lugar distante. Tentou abrir alguns armários mas estavam fechados a chave.

        Mas ali também havia as placas de reforço. Aquela seção era também excepcionalmente reforçada.

        Por quê?, pensou ela. Por que tão reforçada?

        — Veja isto — disse Arby, ao lado de uma das paredes. Era um complexo de LEDs brilhantes e uma porção de botões. Para Kelly parecia um termostato muito complicado.

        — Para que serve? — ela perguntou.

        — Para monitorar o trailer inteiro. Daqui pode-se fazer qualquer coisa. Todos os sistemas, todo o equipamento. E veja isto, uma TV... — Apertou um botão e o monitor acendeu. Viram Eddie caminhando para eles, fora do trailer.

        — Ei, o que é isto? — exclamou Arby. Na parte inferior do LED havia um botão com capa de segurança. Ele abriu a capa. O botão era prateado e dizia DEF.

        — Ei, aposto que é aquela defesa contra ursos de que ele falou. Logo depois Eddie abriu a porta e disse.

        —  Acho melhor parar com isso. Vai descarregar as baterias. Venham, ouviram o que o Thorne disse. Está na hora de ir para casa.

        Kelly e Arby trocaram um olhar.

        — Tudo bem — disse Kelly. — Estamos indo. Relutantes, saíram do trailer.

        Foram para o escritório de Thorne para se despedir. Arby disse:

        — Eu gostaria que nos deixasse ir também.

        — Eu também.

        — Não quero ficar em casa nos feriados —disse ele. — Eles vão trabalhar o tempo todo do mesmo jeito. — Referia-se aos pais.

        — Eu sei.

        Kelly também não queria ir para casa. A idéia dos testes de campo durante os feriados era perfeita para ela porque significava ficar fora de casa e longe de uma situação desagradável. Sua mãe trabalhava para uma empresa de seguros como processadora de dados durante o dia e à noite era garçonete no Denny's. Desse modo, estava sempre trabalhando, e seu mais recente namorado, Phil, costumava passar muito tempo na casa delas, à noite. Tudo estava bem quando Emily, sua irmã, estava em casa, mas agora ela estava estudando enfermagem no colégio da comunidade e Kelly ficava sozinha. E Phil era meio sinistro. Mas sua mãe gostava dele e não queria ouvir nenhuma queixa. Ela sempre dizia para Kelly tratar de crescer.

        Agora estava indo ao escritório de Thorne com a esperança impossível de que ele cedesse no último momento. Ele estava falando ao telefone, de costas para eles. Na tela do computador estavam as imagens de satélite que haviam levado do apartamento de Levine. Thorne estava trabalhando nas imagens, fazendo ampliações sucessivas. Eles bateram à porta e a abriram um pouco.

        — Até logo, Dr. Thorne.

        — A gente se vê, Dr. Thorne.

        Thorne voltou-se, segurando o fone com uma das mãos.

        —  Até logo, meninos. — Acenou rapidamente com a outra mão.

        Kelly hesitou. — Escute, será que podemos falar um minuto sobre... Thorne balançou a cabeça.

        — Não.

        — Mas...

        —  Não, Kelly. Agora, tenho de dar este telefonema. Já são quase quatro horas da manhã na África e daqui a pouco ela vai dormir.

        —  Quem?

        — Sarah Harding.

        — Sarah Harding vai também? — Kelly perguntou, da porta.

        — Eu não sei. — Thorne deu de ombros. — Tenham um bom feriado, meninos. Vejo vocês daqui a uma semana. Obrigado pela ajuda. Agora, sumam daqui. — Olhou para o galpão. — Eddie, os meninos estão saindo. Mostre a porta para eles e, quando saírem, tranque por dentro! Apanhe os documentos! E faça sua mala, você vai comigo! — Então, mudando o tom de voz, disse: — Sim, telefonista, ainda estou esperando.

        E deu as costas para os meninos.

       

       HARDING

        Através dos vidros dos óculos de visão noturna, o mundo aparecia em tons de verde fluorescente. Sarah Harding olhou para a savana africana. Diretamente à frente, acima da relva alta, ela avistou a saliência rochosa de uma colina. Pequenos pontos verdes se refletiam nas rochas. Provavelmente alguns híraces, pensou ela, ou outro pequeno roedor qualquer.

        De pé no jipe, com um blusão de malha para se proteger do frio da noite, sentindo o peso dos óculos enormes, ela virava a cabeça lentamente. Ouvia o ganido na noite e tentava descobrir de onde vinha.

        Ela sabia que, mesmo de pé como estava, não poderia ver o animal. Virou devagar para o norte, esperando ver algum movimento na relva. Nada. Voltou-se rapidamente para o outro lado e o mundo verde girou também. Agora estava olhando para o sul.

        E ela os viu.

        A relva ondulou num movimento variado quando a alcatéia correu para a frente, ganindo e latindo, preparada para o ataque. Sarah viu de relance a fêmea que ela chamava de Face Um, ou Fl. Fl distinguia-se dos outros por uma linha branca entre os olhos. Fl seguiu com passos largos, com o corpo meio de lado, como correm todas as hienas. Com os dentes arreganhados, ela olhou para trás, verificando a posição da alcatéia.

        Sarah Harding moveu os óculos na escuridão, olhando para a frente da alcatéia e viu a presa. Uma manada de búfalos africanos, de pé na relva alta que ia até suas barrigas, todos agitados. Os búfalos mugiam e batiam as patas no chão.                  

        As hienas uivaram mais alto, um padrão sonoro destinado a confundir a presa. Correram para a manada tentando separar as crias das mães. O búfalo africano parece lerdo e tolo, mas na verdade está entre os mamíferos selvagens africanos mais perigosos, criaturas pesadas e muito fortes com chifres pontiagudos e extremamente mal-humoradas. As hienas não tinham meios para derrubar um adulto, a não ser que estivesse doente ou ferido.

        Mas iam tentar apanhar um bezerro.

        Sentado atrás da direção do jipe, Makena, seu assistente, perguntou:

        — Você quer chegar mais perto?

        — Não, aqui está ótimo.

        Na verdade, estava mais do que ótimo. O jipe estava numa pequena elevação e a visão era boa. Com sorte, ela poderia gravar todo o padrão do ataque. Sarah ligou a câmera de vídeo, montada num tripé um metro e meio acima da sua cabeça, e começou a ditar rapidamente no gravador.

        — Fl sul, F2 e F5 um de cada lado a vinte metros. F3 no centro. F6 fazendo uma volta larga a leste. Não posso ver F7. Diretamente para a frente. F8 aproximando-se diagonalmente do norte. Aparecendo, fazendo uma volta outra vez.

        Era o comportamento clássico das hienas. Os líderes correm entre a manada, enquanto os outros fazem um círculo e depois avançam de todos os lados. O búfalo não pode localizar todos os atacantes. Sarah ouviu o mugido dos búfalos quando a manada entrou em pânico e desfez a formação compacta. Os grandes animais separaram-se, virando as cabeças, olhando. Harding não via as crias, estavam escondidas pela relva alta. Mas ouvia seus gritos lamentosos.

        Agora as hienas estavam voltando. Os búfalos bateram os pés, abaixaram as cabeças ameaçadoramente. A relva ondulou quando as hienas armaram o círculo, uivando e latindo, agora mais em staccato. Sarah viu de relance a fêmea F8, com o focinho já vermelho. Mas não chegou a ver o ataque.

        A manada de búfalos andou um pouco para o leste e se reagrupou. Uma fêmea estava separada dos demais. Ela mugia continuamente para as hienas. Elas deviam ter apanhado sua cria.

        Harding ficou frustrada. Tudo aconteceu muito depressa — demasiado depressa, o que só podia significar que as hienas tinham tido sorte ou que o bezerro estava ferido. Ou talvez fosse muito novo, até mesmo recém-nascido. Algumas fêmeas estavam ainda tendo suas crias. Precisava estudar o videoteipe e tentar reconstruir o que tinha acontecido. Os perigos de estudar animais noturnos muito rápidos, pensou ela.

        Mas não tinha dúvida de que as hienas haviam apanhado um animal. Todas estavam agrupadas numa mesma área no meio da relva, ganindo e saltando. Ela viu F3 e depois F5 com os focinhos sujos de sangue. Depois chegaram os filhotes para tirar sua parte da presa. Os adultos imediatamente abriram caminho para eles, e os ajudaram a devorar o búfalo. Às vezes tiravam um pedaço de carne da carcaça e davam para os filhotes.

        Sarah Harding, que recentemente havia se tornado a maior especialista em hienas no mundo, conhecia bem esse comportamento. Quando publicou suas descobertas, foi recebida com incredulidade e até mesmo má-vontade pelos colegas, que discutiram os resultados do seu estudo em termos extremamente pessoais. Foi atacada por ser mulher, por ser atraente, por ter uma "perspectiva predominantemente feminista". A universidade a advertiu de que ela era candidata a um cargo vitalício como docente. Os colegas balançaram a cabeça. Mas Harding não desistiu, e lentamente, com o passar do tempo, à medida que acumulava mais dados, sua descrição do comportamento das hienas foi sendo aceita.

        Contudo, as hienas não podiam ser consideradas criaturas agradáveis, pensou ela, enquanto as via devorar a presa. Eram feias, a cabeça grande demais, o corpo curvo, o pêlo sujo e emaranhado, o andar desajeitado, a voz lembrando demasiado uma risada sinistra. Num mundo cada vez mais urbano de arranha-céus de concreto, os animais selvagens eram romantizados, classificados como nobres ou ignóbeis, heróis ou vilões. E nesse mundo dirigido pela mídia, as hienas simplesmente não eram bastante fotogênicas para ser admiradas. Há muito tempo classificadas como os vilões que riam nas planícies da África, ninguém as julgava dignas de um estudo sistemático, até Harding começar sua pesquisa.

        O que ela descobriu mostrava as hienas por uma ótica muito diferente. Bravas caçadoras e pais zelosos, viviam numa notável e complexa estrutura social — além de tudo, um matriarcado. Quanto ao famoso uivo ou gargalhada, representava uma forma sofisticada de comunicação.

        Sarah ouviu um rugido e com seus óculos de visão noturna viu o primeiro leão aproximar-se da presa. Era uma leoa grande e se aproximava em círculos. As hienas latiram e arreganharam os dentes para a leoa, afastando suas crias para o meio da relva alta. Logo surgiram outros leões e começaram a devorar a presa das hienas.

        Agora, os leões, pensou ela. Esses, sim, são animais realmente malvados. Embora chamado o rei dos animais, o leão é na realidade cruel e...

        O telefone tocou.

        — Makena — ela disse.

        O telefone tocou outra vez. Quem podia ser àquela hora?

        Através dos óculos ela viu a leoa levantar a cabeça e olhar para dentro da noite.

        Makena estava procurando o telefone debaixo do painel do jipe. Tocou mais três vezes antes de ele atender.

        Sarah o ouviu dizer:

        — Jambo, mzee. Sim, a Dra. Harding está aqui. — Estendeu o telefone para ela. — É o Dr. Thorne.

        Com relutância, ela tirou os óculos de visão noturna e apanhou o telefone. Ela conhecia bem Thorne, quase todo o equipamento do seu jipe fora desenhado por ele.

        — Thorne, acho bom que seja importante.

        — É importante — disse Thorne.   — É sobre Richard.

        — O que sobre Richard? — Sarah não compreendeu a preocupação que notou na voz dele. Ultimamente Levine estava sendo um chato de primeira, telefonando para ela quase diariamente da Califórnia, procurando aprender tudo o que ela sabia sobre trabalho de campo com animais. Fazia perguntas sobre esconderijos, emboscadas, protocolos de dados, organização de registros e assim por diante, interminavelmente.

        — Ele chegou a dizer a você o que pretendia estudar? — perguntou Thorne.

        — Não. Por quê?

        — Nada mesmo?

        — Não — repetiu Harding. — Estava muito misterioso. Mas eu concluí que ele havia localizado uma população animal que poderia usar para provar alguma coisa sobre sistemas biológicos. Você sabe como ele é obcecado por isso. Por quê?

        — Bem, ele desapareceu, Sarah. Malcolm e eu pensamos que está em apuros. Nós o localizamos numa ilha na Costa Rica e vamos para lá agora.

        — Agora?

        — Esta noite. Voamos de San José dentro de uma hora. Ian vai comigo. Gostaríamos que você viesse também.

        —  Thorne — ela disse. — Mesmo que tomasse um avião em Seronera amanhã de manhã para Nairóbi, levaria quase um dia para chegar lá. Isso se eu tiver sorte, quero dizer...

        — Você decide — interrompeu Thorne. — Vou dar os detalhes, e você resolve o que quer fazer.

        Deu toda a informação, e ela anotou em um bloco preso no seu pulso. Depois Thorne desligou.

        Sarah olhou para a noite africana, sentindo a brisa fria no rosto. No escuro ouviu o rosnado dos leões devorando a presa. Seu trabalho era ali. Sua vida era ali.

        Makena disse:

        — Dra. Harding? O que vamos fazer?

        —  Vamos voltar. Preciso fazer as malas.

        — Vai partir?

        — Sim — disse Sarah. — Eu vou partir.

       

       A MENSAGEM

        Com Thorne na direção, foram para o aeroporto, as luzes de San Francisco desaparecendo atrás deles. Malcolm estava sentado ao lado dele. Olhou para trás, para o Explorer que o seguia e disse:

        — Eddie sabe do que se trata?

        — Sabe — disse Thorne. — Mas não sei se ele acredita.

        — E os garotos não sabem?

        Ouviram um bip ao lado dele. Thorne apanhou o pequeno Envoy preto, um pager. Uma luz estava piscando. Thorne ligou a tela e o entregou para Malcolm.

        — Leia para mim.

        —  É de Arby — disse Malcolm. — Diz: "Façam uma boa viagem. Se precisarem de nós, é só chamar. Estaremos aqui se precisarem da nossa ajuda." E dá o número do telefone.

        Thorne riu.

        — A gente tem de gostar desses garotos. Nunca desistem. — Depois franziu a testa. — Qual é a hora da mensagem?

        —  Foi enviada há quatro minutos — disse Malcolm. — Via netcom.

        — Tudo bem. Só checando.

        Viraram para a direita, a caminho do aeroporto. Viam as luzes adiante. Malcolm olhou para a frente, sombrio.

        — É uma imprudência nos precipitarmos deste modo. Não é o modo certo de fazer as coisas.

        — Vai dar tudo certo — disse Thorne. — Desde que seja essa a ilha.

        — É essa — disse Malcolm.

        — Como você sabe?

        — A pista mais importante foi uma coisa que eu não quis dizer para as crianças. Alguns dias atrás, Levine viu a carcaça de um dos animais.

        -Oh?

        — Sim. Ele teve oportunidade de ver de perto antes de a polícia queimar. E descobriu que o animal estava etiquetado. Ele cortou a etiqueta e a mandou para mim.

        — Etiquetado? Quer dizer, como...

        — Sim. Como um espécime biológico. A etiqueta era antiga e tinha sinais de ácido sulfúrico.

        — Deve ser vulcânico — disse Thorne.

        — Exatamente.

        — E você diz que era uma etiqueta antiga?

        — De vários anos — disse Malcolm. — Porém o mais interessante foi descobrir como o animal morreu. Levine concluiu que o animal foi ferido enquanto vivo, um corte profundo na perna que chegava até o osso.

        — Está dizendo que o animal foi ferido por outro dinossauro?

        — Sim. Exatamente.

        Ficaram em silêncio por algum tempo.

        — Quem mais sabe dessa ilha além de nós?

        — Eu não sei — disse Malcolm. — Mas alguém está tentando descobrir. Hoje invadiram o meu escritório para tirar fotografias.

        —  Grande — suspirou Thorne. — Mas você não sabia onde ficava a ilha, sabia?

        — Não. Eu ainda não tinha todos os dados.

        — Acha que mais alguém pode ter?

        — Não — disse Malcolm. — Estamos sozinhos.

        

       A EXPLORAÇÃO

        Lewis Dodgson abriu a porta onde estava escrito ALOJAMENTO DOS ANIMAIS, e imediatamente todos os cães começaram a latir. Dodgson seguiu pelo corredor entre as gaiolas, umas sobre as outras, alcançando três metros de altura. O prédio era grande. A Biosyn Corporation de Cupertino, Califórnia, precisava de uma vasta área para seus testes em animais.

        Ao lado dele, Rossiter, o diretor da empresa, passou a mão na lapela do terno italiano.

        — Eu detesto este maldito lugar. Por que me trouxe aqui?

        — Porque precisamos falar sobre o futuro — disse Dodgson.

        — Isto aqui fede — disse Rossiter, olhando para o relógio. — Vamos com isso. Fale de uma vez, Lewis.

        — Podemos falar aqui. — Dodgson o levou para a cabine de vidro do superintendente, no centro do prédio. O vidro impedia que ouvissem os latidos. Mas podiam ver os animais enjaulados.

        — É simples — disse Dodgson, começando a andar de um lado para o outro. — Mas acho que é importante.

        Lewis Dodgson tinha quarenta e cinco anos, rosto liso e uma calva incipiente. Seus traços eram jovens e seus modos suaves. Mas as aparências enganam — Dodgson, com seu rosto de bebê, era um dos mais desumanos e agressivos geneticistas da sua geração. A controvérsia tinha acompanhado sua carreira. Quando estudante de graduação na Hopkins, ele fora expulso por planejar uma terapia genética humana sem a permissão do FDA. Mais tarde, depois que começou a trabalhar para a Biosyn, conduziu o teste bastante controvertido de uma vacina contra a raiva, no Chile — os agricultores ignorantes usados por ele não haviam sido informados de que estavam servindo de cobaias.

        Nos dois casos, Dodgson explicou que era um cientista muito apressado e não podia ser detido pelos regulamentos criados por pessoas de menor importância. Ele se definia como "voltado para resultados", o que na realidade significava que fazia tudo o que considerasse necessário para atingir sua meta. Era também um incansável mestre da autopromoção. Dentro da empresa, Dodgson se apresentava como um pesquisador, muito embora não tivesse habilidade para nenhuma pesquisa original e nunca tivesse feito nenhuma. Seu intelecto era fundamentalmente derivativo. Dodgson jamais concebia uma idéia antes que alguém falasse primeiro no assunto. Ele era muito bom em "desenvolvimento de pesquisa", ou seja, roubar o trabalho dos outros quando estavam nos primeiros estágios de estudo. Nesse particular Dodgson era completamente sem escrúpulos e sem igual. Durante muitos anos dirigiu a seção de engenharia reversa da Biosyn, que, teoricamente, examinava os produtos dos concorrentes para determinar como eram feitos. Mas na prática, a "engenharia reversa" envolvia uma boa parte de espionagem industrial.

        Rossiter, é claro, não tinha ilusões sobre Dodgson. Não gostava dele e o evitava tanto quanto possível. Dodgson estava sempre correndo riscos, cortando caminho, e deixava Rossiter nervoso. Mas Rossiter sabia também que a biotecnologia moderna era extremamente competitiva. Para continuar competitiva, cada empresa precisava de um homem como Dodgson. E Dodgson era muito bom no que fazia.

        —  Vou direto ao assunto — disse Dodgson. — Se agirmos depressa, acho que teremos oportunidade de adquirir a tecnologia da InGen.

        Rossiter suspirou.

        — Outra vez, não...

        —  Eu sei, Jeff. Sei o que você pensa. Admito que há uma história nisso tudo.

        — História? A única história é que você falhou, mais de uma vez. Já tentamos isso, pela porta da frente e pela porta dos fundos. Une diabo, tentamos até comprar a empresa quando ela entrou em concordata, porque você nos disse que estava à venda. Mas acontece que não estava. Os japoneses não queriam vender. .

        — Eu compreendo, Jeff. Mas não vamos esquecer que...

        —  O que eu não posso esquecer — disse Rossiter — é que pagamos setecentos e cinqüenta mil dólares para seu amigo Nedry e ficamos de mãos vazias.

        — Mas, Jeff...

        — Depois pagamos quinhentos mil dólares para aquele agente matrimonial, Dai-Ichi. Não vimos nada também. Nossas tentativas de adquirir a tecnologia da InGen foram um fracasso de merda. É isso o que eu não posso esquecer.

        — Mas o caso — disse Dodgson — é que continuamos tentando por uma boa razão. Essa tecnologia é vital para o futuro da empresa.

        — É o que você diz.

        — O mundo está mudando, Jeff. Estou falando em resolver um dos problemas mais importantes desta empresa no século XXI.

        — E qual é o problema?

        Dodgson apontou para os cães, que continuavam a ladrar.

        —  Experiências com animais. Vamos encarar os fatos, Jeff. Cada ano a pressão fica maior no sentido de proibir o uso de animais para testes e pesquisa. A cada ano aumenta o número de demonstrações de protesto, mais invasões, mais ataques da imprensa. No princípio eram só os fanáticos simplórios e as celebridades de Hollywood. Mas agora é um movimento vitorioso, até as universidades, os filósofos estão começando a dizer que é contra a ética submeter macacos, cães e até mesmo ratos às indignidades da pesquisa de laboratório. Tivemos até protestos contra nossa "exploração" das lulas, embora elas continuem em todas as mesas do mundo. Ouça o que eu digo, Jeff, é uma moda sem fim. Qualquer dia alguém vai dizer que não podemos explorar as bactérias para fazer produtos genéticos.

        — Ora, deixe disso.

        —  Espere para ver. Vai acontecer. E então fecharemos as portas. A não ser que tenhamos um animal genuinamente criado por nós. Pense um pouco — um animal extinto, trazido de volta à vida, para todos os fins práticos não é um animal, não pode ter nenhum direito. Já está extinto. Portanto, se ele existe, só pode ser uma coisa que nós fizemos. Nós o fizemos, nós o patenteamos, ele nos pertence. E é um perfeito objeto para testes. E acreditamos que os sistemas, as enzimas e os hormônios dos dinossauros são idênticos aos sistemas dos mamíferos. No futuro, os medicamentos podem ser testados em pequenos dinossauros com o mesmo sucesso com que são hoje testados em cães e ratos, com muito menor risco de um processo legal. Rossiter balançou a cabeça.

        — E o que você pensa.

        — Eu sei. Basicamente eles são lagartos grandes, Jeff. E ninguém gosta de lagartos. Não são como aqueles cãezinhos engraçadinhos que lambem sua mão e comovem seu coração. Os lagartos não têm personalidade. São cobras com pernas.

        Rossiter suspirou.

        — Jeff, estamos falando de verdadeira liberdade. Porque neste momento tudo o que é relacionado com animais vivos está amarrado com nós legais e morais. Os caçadores de animais de grande porte não podem matar um leão ou um elefante, os mesmos animais que seus pais e seus avós costumavam caçar para depois posar orgulhosamente para a foto. Agora existem formulários, licenças, despesas — e muito sentimento de culpa. Hoje em dia você não tem coragem de atirar num tigre e admitir que atirou. No mundo moderno matar um tigre é uma transgressão muito mais séria do que matar os próprios pais. Os tigres têm seus defensores. Mas, agora, imagine. Uma reserva de caça especialmente equipada, talvez em algum lugar da Ásia, onde pessoas ricas e importantes podem caçar tiranossauros e tricerátops num ambiente natural. Seria uma atração incrivelmente desejável. Quantos caçadores têm uma cabeça de alce empalhada na parede? O mundo está cheio deles. Mas quantos podem se gabar de ter a cabeça de um tiranossauro com os dentes arreganhados pendurada acima do seu bar?

        — Não fala sério.

        — Estou tentando explicar a importância do assunto, Jeff. Os animais são completamente exploráveis. Podemos fazer o que quisermos com eles.

        Rossiter levantou-se e pôs as mãos nos bolsos. Suspirou, depois olhou para Dodgson.

        — Os animais ainda existem?

        Dodgson balançou a cabeça lenta e afirmativamente.

        — E você sabe onde estão? Outra vez o mesmo movimento.

        — Tudo bem — disse Rossiter. — Pois então faça. Caminhou para a porta, parou e olhou para trás.

        — Mas, Lewis, quero que fique bem claro. Esta é decididamente a última vez. Ou você consegue os animais agora, ou está acabado. Esta é a última vez. Entendeu?

        —  Não se preocupe — disse Dodgson. — Desta vez eu vou conseguir.

     

      TERCEIRA  CONFIGURAÇÃO

       

        Na fase intermediária, o desenvolvimento rápido da complexidade no interior do sistema disfarça o risco do caos iminente. Mas o risco está lá.

        IAN MALCOLM

       

       COSTA RICA

        Chovia copiosamente em Puerto Cortês. A chuva batia com força no teto do pequeno galpão de metal ao lado do aeroporto. Completamente molhado, Thorne esperou que o funcionário da alfândega da Costa Rica examinasse repetidamente seus documentos. O nome dele era Rodríguez e era apenas um rapaz de vinte e poucos anos, com um uniforme deselegante e morrendo de medo de cometer algum erro.

        Thorne olhou para a pista, onde à luz incerta do amanhecer os conteineres de carga estavam sendo presos à parte inferior de dois grandes helicópteros Huey. Eddie Carr estava fora na chuva, com Malcolm, gritando para orientar os homens que fixavam as presilhas da carga.

        Rodríguez folheou outra vez os papéis.

        — Agora, Senor Thorne, de acordo com estes documentos, seu destino é a Islã Sorna...

        — Exatamente.

        — E seus contêineres contém apenas veículos?

        — Sim, isso mesmo. Veículos de pesquisa.

        — Sorna é um lugar primitivo. Não há suprimento de combustível, nem mesmo o que se possa chamar de estrada...

        — Já esteve lá?

        — Não. As pessoas daqui não se interessam por essa ilha. É um lugar selvagem, rochas e selva. E não há lugar para atracar um barco, exceto em condições atmosféricas muito especiais. Por exemplo, hoje não se pode chegar à ilha.

        — Compreendo — disse Thorne.

        —  Espero que estejam bem preparados para as dificuldades que vão encontrar.

        — Acho que estamos.

         — Estão levando combustível suficiente para os veículos? Thorne suspirou. Para que ter o trabalho de explicar?

        — Sim, estamos.

        —  E são apenas três pessoas, o Dr. Malcolm, o senor e seu assistente, o Senor Carr?

        — Correto.

        — E pretendem ficar na ilha menos de três semanas?

        — Exatamente. Talvez uns dois dias. Se tivermos sorte, esperamos sair da ilha amanhã.

        Rodríguez examinou os documentos outra vez, como se estivesse procurando uma pista secreta.

        — Bem...

        —  Algum problema? — perguntou Thorne, consultando o relógio.

        — Nenhum problema, Senor. Sua permissão está assinada pelo diretor geral das Reservas Biológicas. Está tudo em ordem... — Rodríguez hesitou. — Mas essa permissão é bastante incomum.

        — Por quê?

        —  Eu não conheço os detalhes, mas há alguns anos houve algum problema numa das ilhas e desde então o Departamento de Reservas Biológicas fechou aos turistas todas as ilhas do Pacífico.

          — Não somos turistas — disse Thorne.

        — Eu sei disso, Senor Thorne.                                  

         Tornou a examinar os documentos.    

        — Thorne esperou.

        Na pista, as presilhas pareciam estar todas encaixadas e os contêineres foram erguidos do solo.

        — Muito bem, Senor Thorne — Rodríguez disse, finalmente, carimbando os papéis. — Desejo boa sorte.

        — Muito obrigado — disse Thorne. Guardou os documentos no bolso, inclinou a cabeça para se proteger da chuva e correu para a pista.

        Quatro quilômetros ao largo da costa, os helicópteros atravessaram a camada de nuvens para o sol do começo da manha. Do cockpit do Huey que ia na frente, Thorne avistava toda a costa. Viu cinco ilhas a distâncias variadas da costa — picos rochosos erguendo-se do mar azul. Eram separadas umas das outras por apenas alguns quilômetros, sem dúvida parte de uma antiga cadeia vulcânica. Ele apertou o botão para transmitir.

        —  Qual delas é Sorna?                                                  

         O piloto apontou para a frente.

        —  Nós as chamamos de Cinco Mortes — disse ele. — Isla Muerte, Isla Matanceros, Isla Pena, Isla Tacana e Isla Sorna, que é aquela grande ao norte.

        — Você já esteve lá?

        — Nunca, Senor. Mas acredito que haja um lugar para pousar.

        — Como sabe?

        — Há alguns anos houve alguns vôos para a ilha. Ouvi dizer que os americanos voavam até lá às vezes.

        — Não eram alemães?

        —  Não, não. Não temos tido alemães desde... eu nem sei quando. A guerra mundial. Eram americanos.

        —  Quando foi isso?

        — Não tenho certeza. Talvez há uns dez anos.

        O helicóptero virou para o norte, passando sobre a ilha mais próxima. Thorne viu terreno acidentado e vulcânico, coberto pela selva densa. Não havia sinal de vida ou de habitação humana.

        — Para os habitantes locais, essas ilhas não são lugares felizes — disse o piloto. — Eles dizem que nada de bom pode vir delas. — Ele sorriu. — Mas eles não sabem de nada. São índios supersticiosos.

        Estavam agora sobre mar aberto com a Isla Sorna diretamente na frente. Era sem dúvida uma cratera vulcânica. Paredes de rocha nuas, avermelhadas, um cone gasto pela erosão.

        —  Onde os barcos atracam?

        O piloto apontou para onde o mar batia nos rochedos escarpados.

        —  No lado leste desta ilha, há várias cavernas, feitas pelas ondas. Alguns dos habitantes locais a chamam de Isla Gemido, por causa do barulho das ondas dentro das cavernas. Algumas dessas cavernas estendem-se para o interior e um barco pode passar por elas em determinadas épocas. Mas não como tempo que temos hoje. Thorne pensou em Sarah Harding. Se tivesse resolvido vir, deveria chegar mais tarde.

        — Tenho uma colega que talvez chegue hoje à tarde — disse. — Pode trazê-la até a ilha?

        — Eu sinto muito — disse o piloto. — Temos um trabalho em Golfo Juan. Só voltaremos à noite.

        — O que ela pode fazer?

        O piloto olhou atentamente para o mar.

        — Talvez possa vir de barco. O mar muda de uma hora para outra. Ela pode ter sorte.

        — E você vai voltar amanhã para nos levar de volta?

        — Sim, Senor Thorne. Voltaremos bem cedo. É a melhor hora para os ventos.

        O helicóptero fez a aproximação pelo oeste, subindo algumas dezenas de metros, sobrevoando os rochedos para revelar o interior da Islã Gemido. Parecia exatamente como outras cadeias e desfiladeiros vulcânicos, recoberta pela mata densa. Era bela vista do ar, mas Thorne sabia que ia ser extremamente difícil se movimentar no solo. Olhou atentamente para baixo, à procura de estradas.

        O helicóptero desceu um pouco, voando em círculos sobre a área central da ilha. Thorne não viu nenhuma construção, nenhuma estrada. O helicóptero começou a descer na direção da selva. O piloto disse:

        — Por causa dos rochedos os ventos aqui são péssimos. Muitas rajadas e correntes. Só num ponto da ilha é seguro pousar. — Olhou pela janela. — Ah, sim. Lá está.

        Thorne viu uma clareira atapetada por relva alta.

        — Nós pousamos ali — disse o piloto.

       

       ISLÃ SORNA

        Eddie Carr, de pé na relva alta da clareira, deu as costas para a poeira levantada pelos dois helicópteros, que já levantavam vôo. Alguns minutos depois eram pequenos pontos ao longe e quase não se ouviam os motores. Eddie pôs a mão em pala na testa e olhou para cima. Perguntou, com desânimo na voz:

        — Quando vão voltar?

        — Amanhã de manhã — disse Thorne. — A essa hora já teremos encontrado Levine.

        —  Pelo menos, é bom que o tenhamos encontrado — disse Malcolm.

        Então os helicópteros desapareceram completamente no outro lado da cratera. Carr ficou com Malcolm na clareira, envolta pelo calor do sol da manhã e pelo silêncio profundo da ilha.

        — Isto aqui é de arrepiar — disse Eddie, puxando a aba do boné de beisebol para baixo, sobre os olhos.

        Eddie Carr tinha vinte e quatro anos e crescera em Daly City. fisicamente era compacto e forte e tinha cabelos escuros. O corpo era atarracado, os músculos salientes mas as mãos elegantes, com dedos longos e bem-feitos. Eddie tinha um talento — Thorne diria um gênio — para coisas mecânicas. Eddie podia construir qualquer coisa, consertar qualquer coisa. Via como as coisas funcionavam apenas olhando para elas. Trabalhava para Thorne há três anos, seu primeiro emprego depois que se formou no colégio comunitário. Era para ser um emprego temporário. Queria ganhar dinheiro para voltar a estudar e conseguir um diploma universitário. Mas Thorne logo se tornou dependente de Eddie. Quanto a Eddie, não estava mesmo muito interessado em voltar aos livros.

        Apesar disso tudo, não contava com uma coisa como essa, pensou ele, olhando em volta. Eddie era um homem da cidade, acostumado ao movimento urbano, às buzinas e ao tráfego intenso. Aquele silêncio desolador o deixava nervoso.

        —  Venha — disse Thorne, pondo a mão no ombro dele. — Vamos começar.

        Caminharam para os contêineres que os helicópteros haviam deixado a poucos metros, na relva alta.

        —  Posso ajudar? — perguntou Malcolm, a alguma distância dos dois.

        — Se não se importa, não — disse Eddie. — Acho melhor nós mesmos nos encarregarmos disto.

        Levaram meia hora para desaparafusar os painéis traseiros, abaixá-los no chão e entrar nos contêineres. Depois disso, em poucos minutos retiraram os veículos. Eddie entrou no Explorer e ligou o motor, que pegou com um leve murmúrio quase inaudível da bomba de vácuo. Thorne disse:

        — Como está a sua carga?                                                    

        — Completa — disse Eddie.

        — Baterias em ordem?                                                        

        — Sim. Parecem ótimas.                                                     

        Foi um alívio para Eddie. Ele havia supervisionado a conversão dos motores dos veículos para motores movidos a eletricidade, mas fora um trabalho feito às pressas e não haviam tido tempo para uma revisão. Embora os carros elétricos tivessem uma tecnologia menos complexa que a dos motores de combustão interna — aquela relíquia resfolegante do século XIX —, Eddie sabia que era sempre arriscado levar para o campo equipamento não-testado.

        Especialmente quando o equipamento usava também a mais nova tecnologia. Isso o preocupava mais do que ele queria admitir. Como a maioria dos mecânicos natos, Eddie era profundamente conservador. Gostava que as coisas funcionassem — em qualquer situação — e para ele isso significava o uso de tecnologia estabelecida e comprovada. Infelizmente dessa vez ele fora derrotado na votação.   

        Duas coisas o preocupavam especialmente. Uma eram os painéis fotovoltaicos, com as fileiras de lâminas octogonais de silício montadas na capota e no capo dos veículos. Esses painéis eram eficientes e muito menos frágeis do que os antigos fotovoltaicos. Eddie os montou com unidades especiais amortecedoras da vibração, criadas por ele. Mas permanecia o fato. Se os painéis fossem avariados de qualquer modo, já não poderiam fornecer carga para os veículos nem controlar a parte eletrônica. Todos os sistemas cessariam de funcionar.

        Sua outra preocupação eram as baterias. Thorne tinha escolhido as novas baterias de íons de lítio da Nissan, extremamente eficientes em termos de peso. Mas estavam ainda em fase experimental, o que para Eddie era um modo delicado de dizer "não-confiável".

        Eddie sugeriu que levassem alguma garantia — só por segurança —, como um gerador a gasolina. Ele havia sugerido uma porção de outras coisas. E todas as suas sugestões foram descartadas. Nessas circunstâncias, Eddie fez a coisa mais sensata possível. Construiu algumas peças extras e não contou a ninguém.

        Ele tinha certeza de que Thorne sabia. Mas Thorne não disse nada. Eddie também não tocou no assunto. Mas agora que estava naquela ilha, no meio do nada, ficou feliz por ter feito isso. Porque o fato é que, nunca se sabe.

        Thorne observou Eddie tirar o Explorer do contêiner de marcha à ré e levá-lo para a relva. Eddie deixou o carro no centro da clareira, onde a luz do sol podia atingir os painéis, reforçando a carga.

        Thorne sentou na frente da direção do primeiro trailer e deu marcha à ré. Era estranho dirigir um veículo tão silencioso. O ruído mais alto era dos pneus no contêiner de metal. E andando sobre a relva, nem se ouvia. Thorne desceu e uniu os dois trailers com a conexão de aço flexível em forma de sanfona.

        Chegou a vez da motocicleta, também elétrica. Thorne a levou para trás do Explorer, apoiou a máquina nos suportes, ligou o cabo de força no mesmo sistema do veículo e recarregou a bateria. Depois recuou um pouco.  

        — Isso é tudo.          

        Na clareira quente e silenciosa, Eddie olhou para a borda alta e circular da cratera que se erguia à distância acima da selva. A rocha nua cintilava com ondas de calor, uma parede ameaçadora e áspera. Teve uma sensação de abandono, de estar encurralado.

        — Por que alguém ia querer vir a este lugar? — ele perguntou. Malcolm, apoiado na bengala, sorriu.

        — Para fugir de tudo, Eddie. Você nunca tem vontade de fugir de tudo?

        — Não se depender de mim — disse Eddie. — Eu gosto de ter sempre um Pizza Hut por perto, sabe o que quero dizer?

        — Bem, pois está muito longe dele agora.

        Thorne voltou para o painel traseiro do trailer e tirou dois rifles pesados. Sob o cano de cada um havia duas latas de alumínio. Entregou um rifle para Eddie e mostrou o outro para Malcolm.

        — Já tinha visto um destes?

        — Eu li a respeito — disse Malcolm. — E aquela coisa sueca?

        — Certo. Rifle de ar Lindstradt. O rifle mais caro do mundo. Forte, simples, preciso e confiável. Atira um dardo de impacto subsônico Fluger, contendo o que você quiser. — Thorne abriu o tambor, mostrando uma fileira de sacos de plástico com líquido cor-de-palha. Cada cartucho tinha na ponta uma agulha de sete centímetros. — Carregamos com o veneno reforçado de Conus purpurascens, a concha cônica dos Mares do Sul. E a neurotoxina mais poderosa do mundo. Age em dois milionésimos de segundo. Mais rápida do que a velocidade da condução da rede nervosa. O animal cai antes de sentir a picada do dardo.

        — Letal?

        Thorne fez um gesto afirmativo.

        — É preciso muito cuidado. Lembre-se, você não vai querer acertar um deste no seu pé, porque, se isso acontecer, estará morto antes de saber que puxou o gatilho.

        — Há algum antídoto?

        — Não. Mas para quê? Não daria tempo de ser administrado, se houvesse.

        — Isso simplifica as coisas — disse Malcolm, apanhando a arma.

        — Só achei que você devia saber — disse Thorne. — Eddie? Vamos embora.

       

       O REGATO

        Eddie entrou no Explorer e Thorne e Malcolm no primeiro trailer. Um momento depois, o rádio estalou e Eddie disse:

        — Thorne, ligou o banco de dados?

        — Estou ligando — disse Thorne.

        Ligou o disco óptico no painel. No pequeno monitor apareceu a ilha, mas quase toda obscurecida por grupos separados de nuvens.

        — Para que serve isso? — perguntou Malcolm.

        — Espere um pouco —respondeu Thorne. — É um sistema. Vai processar os dados.

        — Dados de quê?

        — Radar.

        Em um instante uma imagem de radar de um satélite apareceu sobre a foto. O radar podia penetrar as nuvens. Thorne apertou um botão e o computador delineou as bordas, reforçando os detalhes, acentuando o traçado fino do sistema de estradas.

        —  Impressionante — disse Malcolm. Thorne sentiu que ele estava tenso.

        — Já peguei! — disse Eddie, no rádio.

        — Ele está vendo a mesma coisa? — perguntou Malcolm.

        — Sim, no painel.

        — Mas eu não estou pegando o GPS — disse Eddie, ansioso. — Não está funcionando?.

        —  Ah, vocês — disse Thorne. — Dêem um tempo. Ele está fazendo a leitura óptica. As estações próximas estão chegando.

        Havia um GPS, o sensor de posicionamento global, cênico, instalado no teto do trailer. O GPS, apanhando os dados de rádio da órbita de navegação dos satélites, a milhares de quilômetros acima dele, podia calcular a posição dos veículos numa área de poucos metros. Então apareceu um X vermelho piscando no mapa da ilha.

        — Tudo bem — Eddie disse no rádio. — Já peguei. Parece uma estrada que sai da clareira na direção norte. É para lá que nós vamos?

        — Eu diria que sim — respondeu Thorne. — De acordo com o mapa, a estrada serpenteia pelo interior da ilha por vários quilômetros antes de chegar ao lugar onde todas as estradas parecem convergir. Havia uma sugestão de construções nesse ponto, mas é difícil ter certeza.

        — Tudo bem, Thorne. Aqui vamos nós.

        Eddie passou por eles, tomando a dianteira. Thorne pisou no acelerador, e o trailer moveu-se silenciosamente, atrás do Explorer. Malcolm estava calado, entretido com um pequeno computador notebook. Nem uma vez ele olhou para fora.

        Deixaram a clareira para trás e dirigiram-se para a selva. As luzes do painel piscaram, indicando que o veículo estava agora ligado às baterias. Sob as árvores, a luz do sol não era suficiente para mover o trailer. Continuaram o caminho.

        — Como vai indo, Thorne? — perguntou Eddie. — Conservando carga?

        — Está tudo ótimo, Eddie.

        — Ele parece nervoso — disse Malcolm.

        — Só preocupado com o equipamento.

        — Nada disso — disse Eddie. — Estou preocupado comigo.

        Embora a estrada estivesse cheia de mato e em péssimo estado, estavam indo bem. Depois de uns dez minutos chegaram a um pequeno regato de margens lamacentas. O Explorer começou a atravessar e depois parou. Eddie saiu do carro e, andando por cima das pedras, foi até o trailer.

        — O que foi?

        — Eu vi alguma coisa, Thorne.

        Thorne e Malcolm desceram do trailer e foram até a margem do regato. Ouviram gritos distintos que pareciam de pássaros. Malcolm olhou para cima, franzindo a testa.

        — Pássaros? — perguntou Thorne.                        

               Malcolm balançou a cabeça negativamente.                         Eddie abaixou e apanhou na lama um pedaço de tecido. Era Gore-Tex verde-escuro, com uma tira de couro costurada na ponta.

        — Isto é de uma das nossas mochilas de expedição — ele disse.

        — Aquela que fizemos para Levine?

        — Sim, Thorne.

        — Você pôs um sensor na mochila? — perguntou Thorne. Geralmente eles costuravam sensores de localização no interior das mochilas para expedições.                                         

        — Sim.

        —  Posso ver isso? — pediu Malcolm. Apanhou a tira de fazenda e a ergueu contra a luz. Depois, esfregou a borda rasgada? com dois dedos, pensativamente.

        Thorne tirou um pequeno receptor do cinto. Parecia um pager grande demais. Olhou para o visor de cristal líquido.

        — Não estou recebendo nenhum sinal...

        Eddie olhou para a margem e abaixou outra vez.               

        —  Aqui está outro pedaço do tecido. E outro. Parece que a mochila foi feita em pedaços, Thorne.                                      

        Outro grito de pássaro flutuou até eles, distante, como vindo de outro mundo. Malcolm olhou para longe, tentando localizar a fonte. E então ouviu Eddie dizer:                                            

        — Oh, oh, temos companhia.

       

        Uma meia dúzia de animais verdes, parecidos com lagartos, estavam parados ao lado do trailer. Eram do tamanho de galinhas c pareciam conversar animadamente. Estavam de pé, apoiados nas pernas traseiras, as caudas retas ajudando no equilíbrio. Quando andavam, balançavam as mãos para baixo e para cima, com movimentos curtos e nervosos, exatamente como uma galinha. E faziam um ruído que lembrava um pássaro, um chiado estridente, mas pareciam lagartos, com suas caudas compridas. Tinham rostos curiosos e alertas e inclinaram a cabeça para o lado quando olharam pura os homens.

        Eddie disse:   

        —  O que é isto? Uma convenção de salamandras?                 

        Os lagartos verdes ficaram parados, observando. Vários outros apareceram, saindo de trás do trailer e da folhagem. Logo havia dezenas de lagartos olhando e tagarelando.

        — Comps — disse Malcolm. — Procompsognathus triassicus é o nome científico.

        — Quer dizer que são...

        — Sim. São dinossauros.

        Eddie franziu a testa e olhou para os animais.

        —  Eu não sabia que podiam ser tão pequenos — ele disse, finalmente.

        — A maioria dos dinossauros era pequena — disse Malcolm. — Todos pensam que eram enormes, mas o dinossauro comum tinha o tamanho de uma ovelha ou de um pequeno pônei.

        — Parecem galinhas — disse Eddie.

        — Sim. Muito parecidos com pássaros.

        — São perigosos? — perguntou Thorne.

        —  Na verdade, não — respondeu Malcolm. — São pequenos necrófagos, como os chacais. Alimentam-se de animais mortos. Mas eu não chegaria muito perto. A mordida deles é extremamente venenosa.

        —  Eu não vou chegar perto — Eddie disse. — Eles me dão arrepios. É como se não tivessem medo de nós.

        Malcolm já havia notado isso.

        — Imagino que seja porque nunca viram um ser humano nesta ilha. Esses animais não têm nenhum motivo para temer o homem.

        — Muito bem, vamos dar um motivo — disse Eddie, apanhando uma pedra.

        — Ei! — exclamou Malcolm. — Não faça isso! E uma... Mas Eddie já tinha atirado a pedra, que caiu perto de um grupo

        de comps e eles recuaram. Mas os outros nem se moveram. Alguns começaram a saltar, demonstrando agitação. Mas ficaram onde estavam. Tagarelando e com as cabeças inclinadas para o lado.

        — De arrepiar — disse Eddie. Farejou o ar. — Estão sentindo o cheiro?

        — Sim — disse Malcolm. — Eles têm um cheiro característico.

        — Cheiro de podre, isso sim — disse Eddie. — Cheiram a coisa podre. Como uma coisa morta. E, se quiser saber, não é natural um animal não demonstrar nenhum medo. E se estiverem com raiva ou coisa assim?

        — Não estão — garantiu Malcolm.

        — Como sabe?

        —  Porque só os mamíferos contraem raiva... — Mas antes mesmo de terminar a frase, Malcolm se perguntou se estava certo. Animais de sangue quente transmitem a raiva. Os comps seriam animais de sangue quente? Não tinha certeza.

        As folhas farfalharam acima deles. Malcolm olhou para o dossel formado pelas árvores. Viu movimento na folhagem, no alto, animais invisíveis, saltando de galho em galho. Ouviu gritos e pios, definitivamente ruídos de animais.

        — Não são pássaros lá em cima — Thorne disse. — Macacos?

        — Talvez, mas eu duvido — disse Malcolm. Eddie estremeceu.

        — Vamos dar o fora daqui.

        Voltou para o regato e entrou no Explorer. Malcolm e Thorne, andando cautelosamente, voltaram para o trailer. Os comps abriram caminho para eles, mas não fugiram. Ficaram em volta das pernas dos dois homens, tagarelando excitados. Malcolm e Thorne entraram e fecharam as portas com cuidado, para não bater com elas nas pequenas criaturas.

        Thorne ligou o motor. Na frente deles, Eddie já estava no meio do regato, a caminho da outra margem íngreme.

        —  Os, hum... procomso-seja-lá-o-que-forem — Eddie disse, no rádio. — Eles são reais, não são?

        — Oh, sim — Malcolm disse, em voz baixa. — Eles são reais.

       

       A ESTRADA

        Thorne estava inquieto. Começava a compreender o que Eddie sentia. Ele havia construído aqueles veículos e tinha uma sensação de isolamento, de estar naquele lugar perdido e distante sem equipamento devidamente testado. Há quinze minutos estavam subindo a estrada íngreme, no meio da selva escura. Dentro do trailer o calor começava a ficar desagradável. Malcolm perguntou:

        — Ar-condicionado?

        — Não quero gastar a bateria.

        — Importa-se se eu abrir a janela?

        — Se acha que convém... — disse Thorne.                                   Malcolm deu de ombros.

        —  Por que não? — Apertou o botão e o vidro abaixou. O ar quente entrou no carro. Ele olhou para Thorne. — Nervoso?

        — Claro — disse Thorne. — Pode apostar que estou. — Mesmo com a janela aberta, o suor descia no seu peito.

        No rádio, Eddie estava dizendo:

        — Vou dizer uma coisa: nós devíamos ter testado o equipamento antes, Thorne. Devíamos ter feito tudo de acordo com as regras. A gente não vem a um lugar com galinhas venenosas quando não se tem certeza de que os veículos vão funcionar direito.

        —  O carro está ótimo — disse Thorne. — Como estão seus níveis?

        — Normais altos — disse Eddie. — Tudo ótimo. E claro que só andamos oito quilômetros. São nove horas da manhã, Thorne.

        A estrada ia para a direita, depois para a esquerda, seguindo numa série de ziguezagues quando o terreno ficava mais íngreme.

        Conduzindo os dois grandes trailers, era um alívio para Thorne ter de se concentrar na direção para evitar outros pensamentos.

        Na frente deles, o Explorer virou para a esquerda, continuando a subida.

        — Não vi mais nenhum animal — disse Eddie, com alívio. Finalmente, depois de chegar ao topo da subida, a estrada ficou plana. De acordo com o que mostrava o GPS, estavam indo para noroeste, para o interior da ilha. Mas a selva ainda os cercava por todos os lados, e não viam muita coisa além da densa parede de folhagem.

        Chegaram a uma bifurcação em Y, e Eddie parou num dos lados da estrada. Thorne viu uma placa de madeira na junção do Y com setas apontando para as duas direções. A da esquerda, com as letras quase apagadas, dizia "Para o Pântano". A da direita indicava "Para o Sítio B".

        Eddie perguntou:

        — Vocês aí, para onde vamos?

        — Para o Sítio B — disse Malcolm.

        —  A caminho. — O Explorer entrou na estrada da direita. Thorne foi atrás. A direita o vapor amarelo de enxofre erguia-se do solo, manchando de branco a folhagem. O cheiro era forte.

        —  Vulcânico — Thorne disse para Malcolm. — Como você previa.

        Passaram pelas nuvens de vapor e viram a cavidade com o líquido fervente, com crostas espessas e amarelas nas bordas.

        — É — disse Eddie —, mas é ativo. Para falar a verdade, eu diria que... caramba! — As luzes de freio do Explorer acenderam e o carro parou de repente.

        Thorne teve de desviar bruscamente, amassando as samambaias ao lado da estrada, para não bater. Parou ao lado do Explorer e olhou zangado para Eddie.

        — Eddie, pelo amor de Deus, será que você podia...

        Mas Eddie não estava ouvindo.                                  

        Estava olhando para a frente de boca aberta. Thorne olhou também.

        As árvores ao lado da estrada tinham sido derrubadas, criando uma abertura na folhagem. Podiam avistar a estrada toda atravessando a ilha para o leste. Mas Thorne mal percebeu a vista panorâmica, porque o que estava vendo era um animal grande, do tamanho de um hipopótamo, andando na estrada. Só que não era um hipopótamo. Era marrom-claro, a pele coberta por enormes escamas que pareciam placas de metal. Em volta da cabeça tinha uma crista óssea curva e no alto da crista dois chifres de ponta redonda. Um terceiro chifre saía do nariz.

        No rádio eles ouviam a respiração entrecortada de Eddie.

        — Vocês sabem o que é isso?

        — Isso é um tricerátops — disse Malcolm. — Jovem ainda, ao que parece.

        — Deve ser — disse Eddie. Na frente deles, outro animal, duas vezes maior do que o primeiro, atravessou a estrada, com chifres longos, curvos e pontiagudos. — Porque essa é a mãe dele.

        Um terceiro tricerátops apareceu, depois um quarto. Um bando inteiro das criaturas atravessava a estrada. Não deram nenhuma atenção aos veículos, passaram pela abertura na folhagem e desceram a colina, desaparecendo.

        Só então os três homens puderam ver o que havia depois da abertura. Thorne viu uma grande planície pantanosa com um rio largo no centro. Na outra margem do rio, viram animais pastando. Ao sul havia uns vinte dinossauros verdes de tamanho médio levantando e abaixando a cabeça grande, comendo a relva na margem do rio. Mais perto, Thorne viu oito dinossauros com focinhos em forma de bico-de-pato e cristas grandes em forma de tubos, grasnando lamentosamente. Bem na frente, viu um estegossauro sozinho, com a curva nas costas e as fileiras verticais de placas cobrindo o corpo todo. A manada de tricerátops passou lentamente pelo estegossauro sem despertar sua atenção. A oeste, erguendo-se acima das árvores de um pequeno bosque, viram uma dezena de pescoços longos e graciosos de apatossauros, os corpos escondidos pela folhagem que eles comiam preguiçosamente. Era uma cena tranqüila, mas uma cena de outro mundo.

        — Thorne? — disse Eddie. — Que lugar é este?

       

       SÍTIO B

        Sentados nos carros, eles olharam para a planície. Viram os dinossauros movendo-se lentamente na relva alta. Ouviram o grito surdo dos bicos-de-pato. As manadas moviam-se pacificamente ao lado do rio. Eddie disse:

        —  Então, o que estamos vendo? Um lugar esquecido pela evolução? Um desses lugares onde o tempo fica parado?

        — Não — disse Malcolm. — Há uma explicação perfeitamente racional para o que você está vendo. E nós vamos...

        Um bip agudo soou no painel. No mapa do GPS apareceu uma grade azul com um ponto triangular piscante e as letras LEVN.

        — É ele! — disse Eddie. — Nós encontramos o filho da mãe!

        — Está lendo isso? — disse Thorne. — Está muito fraco...

        — Está ótimo, tem força suficiente de sinal para transmitir o código de identificação. E Levine, sem dúvida. Parece que vem daquele vale adiante.

        Eddie ligou o motor do Explorer e disse:

        — Vamos. Quero dar o fora daqui.

        Thorne levantou um interruptor, ligando o motor elétrico do trailer, e ouviu a batida da bomba de vácuo, o zumbido da transmissão automática. Ligou a marcha e seguiu o Explorer.

        A selva impenetrável se fechou em volta deles outra vez, cerrada e quente. As árvores na frente bloqueavam quase toda a luz tio sol. O bip começou a ficar irregular. Thorne olhou para o monitor e viu que o triângulo piscante desaparecia e voltava.

        — Nós o estamos perdendo, Eddie? — ele perguntou.

        —  Não tem importância que o percamos — disse Eddie. — Temos sua localização agora e podemos ir direto para lá. Na verdade, deve ser logo adiante, nesta estrada.

        Thorne olhou para além do Explorer e viu uma estrutura de concreto e uma barreira caída para o lado. Parecia uma casa da guarda. Estava maltratada e coberta de trepadeiras. Continuaram e chegaram a uma estrada asfaltada. A folhagem fora cortada, abrindo quinze metros de cada lado. Logo chegaram a uma segunda casa da guarda e a uma segunda barreira.

        Seguiram por mais uns cem metros, a estrada ainda acompanhando a curva da cordilheira. A folhagem tornou-se esparsa, e através das aberturas Thorne viu construções de madeira, todas pintadas de verde. Pareciam galpões para guardar equipamento. Teve a impressão de estar entrando num complexo muito bem aparelhado.

        E então, de repente, quando saíram de uma curva, viram todo o complexo num plano abaixo de onde estavam, mais ou menos a oitocentos metros de distância.

        Eddie disse:                                                                    

        —  Que diabo é aquilo?

       

        Thorne olhava atônito. No centro da clareira viu o telhado plano de um prédio enorme. Cobria uma vasta área, estendendo-se à distância. Tinha o tamanho de dois campos de futebol. Além do telhado enorme viram um prédio grande e compacto com telhado de metal, que parecia uma estação de força, do tamanho de uma estação de força de uma pequena cidade.

        Na extremidade do prédio principal, Thorne viu áreas de carga e descarga e espaços para a manobra de caminhões. A direita, parcialmente escondidas pela folhagem, havia uma série de estruturas pequenas que pareciam moradias. Mas daquela distância era difícil ter certeza.

        No conjunto, todo o complexo tinha uma qualidade utilitária que lembrava um complexo industrial ou uma fábrica. Thorne franziu a testa, tentando identificar aquilo.

        — Você sabe o que é isto? — ele perguntou para Malcolm.

        — Sei. — Malcolm balançou a cabeça afirmativamente. — E do que eu suspeitava há algum tempo.        

        -Sim?

        — É uma fábrica — disse Malcolm.

        — Mas é enorme — observou Thorne.

        — Sim. Tinha de ser. No rádio, Eddie disse:

        — Estou ainda pegando o sinal de Levine. E adivinhem! Parece que vem daquele prédio.

       

        Passaram pela entrada coberta do prédio principal, sob o pórtico meio desmoronado. O prédio era de estilo moderno, concreto e vidro, mas há muito tempo tomado pela selva. Cipós pendiam do teto, os vidros das janelas estavam quebrados, samambaias cresciam entre as rachaduras no concreto.

        — Eddie? — disse Thorne. — Tem alguma leitura?

        — Tenho. Lá dentro. O que vocês querem fazer?

        —  Instalar uma base naquele campo lá adiante. — Thorne apontou para uma extensão oitocentos metros à esquerda onde, ao que parecia, tinha existido um vasto gramado. Formava ainda uma clareira aberta no meio da selva e teriam a luz do sol para as placas fotovoltaicas. — Depois, vamos fazer um reconhecimento.

        Eddie estacionou seu Explorer de frente para o lugar de onde tinham vindo. Thorne manobrou o trailer para ficar ao lado do carro, desligou o motor e saltou para o ar quente e parado da manhã. Malcolm desceu também. Ali, no centro da ilha, o silêncio era completo, exceto pelo zumbido dos insetos.

        Eddie se aproximou, dando tapas no rosto e nos braços.

        — Grande lugar, hein? Não tem racionamento de mosquitos. Querem apanhar o filho da mãe agora? — Tirou um receptor do cinto e protegeu o visor com a mão em concha por causa do sol.

        — Continua lá. — Apontou para o prédio principal. — O que vamos fazer?

        — Vamos apanhá-lo — disse Thorne.

        Os três homens entraram no Explorer e, deixando os trailers, seguiram em direção ao prédio gigantesco em ruínas.

 

       O TRAILER

        Dentro do trailer já não se ouvia o motor do Explorer e o silêncio era completo. O painel estava aceso, o mapa do GPS visível no monitor, o X piscante marcando a posição. Uma pequena janela no monitor, intitulada "Sistemas Ativos", indicava as cargas das baterias, a eficiência fotovoltaica e quanto fora usado nas últimas doze horas. As leituras eletrônicas cintilavam em verde vivo.

        Na parte social, onde ficava a cozinha e as camas, o suprimento recirculador de água gorgolejava discretamente. Então alguma coisa caiu com um baque surdo no compartimento de armazenagem, perto do teto. Outro baque, e depois silêncio.

        Depois de um momento, um cartão de crédito apareceu na fenda da porta do compartimento. O cartão deslizou para cima, levantando a lingüeta da fechadura, abrindo-a. A porta se abriu e um embrulho branco caiu no chão com um ruído surdo. O embrulho rolou e Arby Benton gemeu, esticando o corpo pequeno.

        — Se eu não fizer xixi, vou gritar — ele disse, correndo para o banheiro com as pernas bambas.

        Suspirou aliviado. A idéia fora de Kelly, mas ela deixou a cargo de Arby os detalhes da aventura. E ele havia planejado tudo com perfeição, pensou Arby — pelo menos, quase tudo. Tinha previsto corretamente que o frio seria intenso no compartimento de carga do avião e que precisariam se agasalhar. Encheu o compartimento com todos os cobertores e lençóis que encontrou no trailer. Tinha previsto que ficariam ali pelo menos doze horas e separou alguns biscoitos e garrafas com água. Na verdade, Arby havia previsto tudo, exceto o fato de que, no último minuto, Eddie Carr entrou no trailer trancando todos os compartimentos por fora. Ficaram presos, de modo que, durante doze horas, ele não poderia ir ao banheiro. Doze horas!

        Suspirou outra vez, livre da tensão. Um fluxo contínuo de urina caía ainda no vaso. Não era para menos! Agonia! E ainda estaria preso lá dentro, pensou Arby, se não tivesse pensado em...

        Ouviu a voz abafada atrás dele. Deu a descarga e voltou, abaixando ao lado do compartimento que ficava debaixo da cama. Abriu a porta rapidamente, outro embrulho rolou para fora e Kelly apareceu.

        — Ei, Kel — disse ele, com orgulho. — Nós conseguimos!

        —  Eu tenho de ir — ela disse, correndo para o banheiro e fechando a porta.

        — Nós conseguimos! — disse Arby. — Estamos aqui!

        — Espere um pouco, Arb. Está bem?

        Pela primeira vez ele olhou pela janela do trailer. Estavam no meio de uma clareira coberta de relva, e mais além apareciam as samambaias e as árvores altas da selva. E no alto, acima das copas das árvores, viu a curva da rocha da borda da cratera vulcânica.

        Então estavam mesmo na Islã Sorna.

        Tudo bem!

        Kelly saiu do banheiro.

        — Ohhh! Pensei que fosse morrer! — Olhou para ele e ergueu a mão, fazendo um sinal de tudo bem. — A propósito, como conseguiu abrir a porta?

        — Cartão de crédito. Kelly franziu a testa.

        — Você tem cartão de crédito?

        — Meus pais me deram, para alguma emergência. E eu achei que esta era uma emergência. — Tentou levar a coisa na brincadeira, Arby sabia que Kelly era muito sensível a tudo o que se referia a dinheiro. Estava sempre fazendo comentários sobre as roupas dele e coisas assim. E como Arby sempre tinha dinheiro para o táxi ou para uma Coca-Cola na Larson's Deli, depois das aulas, e assim por diante. Certa vez Arby disse que não achava que o dinheiro fosse tão importante e Kelly respondeu: "Por que você ia achar?", com uma voz debochada. Desde então, ele tentava evitar o assunto.

       

        Arby nem sempre tinha certeza do que era melhor fazer ou dizer. Fosse como fosse, todo o mundo o tratava de modo estranho. Porque era pequeno, é claro. Porque era negro. E porque era o que os outros meninos chamavam de "crânio". Era constante seu esforço para ser aceito, para se encaixar. Mas não conseguia. Não era branco, não era grande, não era bom em nenhum esporte e não era burro. A maior parte das aulas na escola eram tão tediosas que ele mal conseguia ficar acordado. Os professores às vezes se aborreciam com ele, mas o que podia fazer? A escola era como um filme em câmera superlenta. Arby podia olhar para eles uma vez de hora em hora que não perdia nada. E quando estava com os outros meninos, como podia mostrar interesse em programas de televisão? Não podia. Essas coisas não eram importantes.

        Mas tinha descoberto há algum tempo que demonstrar desinteresse não contribuía para sua popularidade. O melhor era ficar de boca fechada. Porque ninguém o compreendia, exceto Kelly. Ela parecia saber do que ele estava falando, a maior parte do tempo.

        E o Dr. Levine. Pelo menos a escola tinha uma linha mais avançada que o interessava moderadamente. Não muito interessante, é claro, mas melhor do que as outras. E quando o Dr. Levine resolveu ensinar na escola, pela primeira vez Arby começou a gostar da escola, de verdade.

        — Então esta é a Islã Sorna, hein? — disse Kelly, olhando pela janela, para a selva.

        — E. Acho que sim.

        — Quando eles pararam aqui na primeira vez, você ouviu o que estavam dizendo?

        — Não muito bem, com toda aquela zoeira.

        —  Eu também não — disse Kelly. — Mas pareciam muito interessados em alguma coisa.

        — Sim, pareciam.

        — Tive a impressão de que falavam sobre dinossauros — disse Kelly. — Ouviu alguma coisa assim?

        Arby riu, balançando a cabeça.

         — Não, Kel — ele disse.      

        — Pois eu acho que estavam.

        —  Ora, deixa disso, Kel. 

        Tive a impressão de ouvir falar em "tricerátops".

        — Kel — ele disse. — Os dinossauros estão extintos há sessenta e cinco milhões de anos.

         — Eu sei...

        Arby apontou para a janela.                             

        — Está vendo algum dinossauro lá fora?

        Kelly não respondeu. Foi para o outro lado do trailer e olhou pela outra janela. Viu Thorne, Malcolm e Eddie entrando no prédio principal.

        — Eles vão ficar danados da vida quando nos encontrarem — disse Arby. — Como acha que devemos dizer que estamos aqui?

        — Acho melhor fazer uma surpresa.                       

         — Vão virar fera — disse ele.                                 

         — E daí? O que podem fazer? — perguntou Kelly.  

        — Podem nos mandar de volta.                                   

        — Como? Não podem.

        — E, acho que não. — Arby deu de ombros fingindo calma, mas estava mais preocupado do que queria admitir. Foi idéia de Kelly. Arby jamais gostou de violar regras, ou de se meter em encrencas. Nas raras ocasiões em que era repreendido por um professor, ele ficava com calor e começava a suar. E nas últimas doze horas tinha pensado na reação de Thorne e dos outros.

        —  Escute — disse Kelly. — O caso é que estamos aqui para ajudar a encontrar nosso amigo, o Dr. Levine, isso é tudo. Nós já ajudamos o Dr. Thorne.

        — Sim...                                         

        — E vamos poder ajudar outra vez.

 —  Talvez...                                                                                           — Eles precisam da nossa ajuda.                              

        — Talvez — repetiu Arby, sem convicção.

        — O que será que eles têm para comer por aqui? — disse Kelly, abrindo a geladeira. — Está com fome?

        —  Morrendo — disse Arby, descobrindo de repente que era verdade.

        — Então, o que você quer?

        —  O que tem aí? — Sentou no sofá cinzento e recostou, enquanto Kelly revistava a geladeira.             

        —  Venha ver — ela disse, aborrecida* — Eu não sou sua empregada babaca.

        — Tudo bem, tudo bem, fica fria.

        — Ora, você espera ser servido por todo o mundo — disse ela.

        — Não é verdade. — Arby levantou rapidamente do sofá.

        — Arby, você é mesmo um pirralho malcriado.

        — Ei, qual é o problema? Fica fria. Está nervosa com alguma coisa?

        — Não, não estou. — Apanhou um sanduíche embrulhado. Ao lado dela, Arby olhou rapidamente para dentro da geladeira

        e apanhou o primeiro sanduíche que viu.

        — Você não quer isso — disse Kelly.

        — Sim, eu quero.

        — E salada de atum.

        Arby detestava salada de atum. Pôs o sanduíche na geladeira e olhou outra vez.

        — Aqueles da esquerda são de peru — ela disse. — Com pão doce.

        Arby apanhou um sanduíche de peru.

        — Obrigado.

        — Tudo bem. — Kelly sentou no sofá, desembrulhou o sanduíche e comeu avidamente.

        —  Escute, pelo menos eu consegui que chegássemos aqui — ele disse, desembrulhando o sanduíche cuidadosamente. Dobrou o plástico e o pôs de lado.

        — Sim, você conseguiu. Eu admito. Fez muito bem essa parte. Arby pensou que jamais havia comido uma coisa tão deliciosa em toda a sua vida. Era melhor até do que os sanduíches de peru que sua mãe fazia.

        Ao lembrar da mãe, sentiu um aperto no estômago. Ela era ginecologista e muito bonita. Levava uma vida intensa e quase nunca estava em casa, mas, quando estava, sempre parecia extremamente tranqüila. E Arby sentia-se tranqüilo perto dela. Os dois tinham um relacionamento muito especial, mas ultimamente às vezes ela parecia preocupada com quanto ele sabia. Uma noite ele entrou no estúdio dela e a encontrou lendo alguns artigos sobre os níveis de progesterona e FSH. Ele olhou por cima dos ombros dela para as colunas de números e sugeriu que ela devia tentar a equação não-linear para analisar os dados. Ela olhou para ele de modo estranho, distante e pensativamente, e naquele momento Arby sentiu...

        — Vou comer outro — Kelly disse, voltando para a geladeira e pegando dois sanduíches, um em cada mão.

        — Acha que tem o bastante para todos?

        —  Quem se importa? Estou morrendo de fome — disse ela, rasgando o plástico de um deles.

        — Talvez a gente não deva comer...

        — Arb, se era para você ficar preocupado desse jeito, devíamos ter ficado em casa.

        Arby resolveu que ela estava certa. Com surpresa viu que tinha comido todo o sanduíche e apanhou o que Kelly oferecia. Kelly comeu olhando pela janela.

        —  O que será aquele prédio onde eles entraram? Parece abandonado.

        — E. Há anos.

        — Por que alguém ia construir tudo isso aqui, nesta ilha deserta da Costa Rica?

        — Talvez estivessem fazendo alguma coisa secreta.

        —  Ou perigosa — disse ela.

        —  E. Ou isso. — A idéia de perigo era ao mesmo tempo excitante e desanimadora. Arby estava se sentindo muito longe de casa.

        — O que será que estavam fazendo? — Ainda comendo, Kelly levantou e foi para a janela. — É mesmo um lugar enorme. Nossa. Que coisa esquisita.

        —  O quê?

        — Venha ver. Aquele prédio está todo coberto de mato, como se há anos não fosse ocupado. E este campo também está com a relva alta demais.

        — Sim.

        —  Mas aqui embaixo — ela disse, apontando para perto do trailer — estou vendo uma trilha limpa.

        Mastigando, Arby olhou. Sim, era verdade. A poucos metros do trailer, a relva estava amassada e amarelada. Em vários lugares aparecia terra. Era uma trilha estreita mas distinta que ia para a direita, atravessando a clareira.

        — Então — disse Kelly. — Se não vem ninguém aqui há anos, o que foi que fez essa trilha?

        — Só pode ser algum animal — disse ele. Não podia pensar em outra coisa. — Deve ser uma trilha de animais.

        — Que animais?

        — Eu não sei. O que tiver por aqui. Gamos ou coisa assim.

        — Não vi nenhum gamo. Ele deu de ombros.

        — Talvez cabras. Você sabe, cabras selvagens, como as que há no Havaí.                                                                            

         — A trilha é larga de mais para ser de cabras.

        — Talvez um rebanho inteiro de cabras selvagens.        

        — Larga de mais — repetiu Kelly. Deu de ombros e se afastou da janela, voltando para a geladeira. — Vou ver se há alguma sobremesa.

        Quando ela falou em sobremesa, Arby teve uma idéia. Foi até o compartimento acima da cama, subiu e começou a procurar.

        —  O que está fazendo? — perguntou Kelly.

        — Verificando a minha mochila.                                    

        —  Procurando o quê?

        — Acho que esqueci a escova de dentes.

        — E daí?

        — Não vou poder escovar os dentes.                       

        — Arb, quem se importa com isso?                                  

        — Mas eu sempre escovo os dentes...

        — Tenha coragem — disse Kelly. — Viva um pouco.     

         Arby suspirou.

        — Talvez o Dr. Thorne tenha trazido uma escova extra. — Sentou no sofá ao lado de Kelly.

        Ela cruzou os braços e balançou a cabeça.

        — Nenhuma sobremesa?

         — Nada. Nem iogurte congelado. Adultos. Nunca planejam as coisas direito.

        — Sim, é verdade.

        Arby bocejou. Estava quente no trailer, e ele começava a sentir sono. Nas doze horas que passou naquele compartimento, não conseguiu dormir, tremendo de frio e quase sem poder se mexer. Agora sentia cansaço.

        Olhou para Kelly e ela bocejou também.

        —  Quer ir lá fora? Para espantar o sono?

        — Acho melhor esperarmos aqui — disse ele.

        — Se eu ficar aqui, acho que vou dormir.

        Arby deu de ombros. O sono estava chegando depressa. Voltou para a parte social do trailer e deitou no colchão debaixo da janela. Kelly foi atrás.

        — Eu não vou dormir — ela disse.

        — Ótimo, Kel. — Os olhos dele estavam pesados. Não dava mais para mantê-los abertos.

        —  Mas — ela bocejou outra vez — acho que vou deitar um pouco, por alguns minutos.

        Arby a viu deitar na outra cama, os olhos dele se fecharam e ele adormeceu. Sonhou que estava outra vez no avião, sentindo o balanço suave, ouvindo o ronco abafado dos motores. Seu sono era leve e em dado momento acordou e podia jurar que o trailer estava balançando e que realmente um ronco surdo parecia vir da janela. Mas voltou a dormir quase imediatamente e dessa vez sonhou com dinossauros. Os dinossauros de Kelly. E no seu sonho leve havia dois animais, tão grandes que não dava para ver as cabeças deles da janela, só as pernas grossas e cobertas de escamas passando, com passos pesados pelo trailer. Mas no sonho o segundo animal parou e se inclinou, a cabeça enorme espiou com curiosidade para dentro do trailer, e Arby compreendeu que estava vendo a cabeça gigantesca de um tiranossauro rex, as mandíbulas enormes abrindo e fechando, os dentes brancos brilhando à luz do sol, e no seu sonho ele viu tudo isso calmamente e voltou a dormir.

       

       INTERIOR

        Duas portas grandes de vaivém na frente do prédio levavam a um saguão escuro. O vidro estava arranhado e sujo, as maçanetas cromadas da porta, manchadas de ferrugem. Mas o arco formado na poeira, nos escombros e nas folhas secas, no chão, indicava que a porta fora aberta recentemente.

        — Alguém abriu esta porta há pouco tempo — disse Eddie.

        — Sim — disse Thorne. — Alguém com botas Asolo. — Ele abriu mais a porta. — Vamos entrar?

        No interior do prédio o ar era quente, parado e malcheiroso. O saguão era pequeno e simples. Um balcão de recepção, bem na frente da porta, devia ter sido antes coberto com tecido de cor cinza, agora substituído por uma camada escura que parecia líquen. Na parede atrás do balcão, letras cromadas diziam: "Nós Fazemos o Futuro", mas as palavras estavam escondidas entre trepadeiras enlaçadas. Cogumelos e fungos cresciam no carpete. A direita viram a sala de espera com uma mesa de centro e dois sofás compridos.

        Um dos sofás tinha manchas de bolor espesso e marrom, o outro estava coberto por um plástico. Perto desse sofá estava o que havia sobrado da mochila verde de Levine, com o tecido todo rasgado. Na mesa estavam duas garrafas de plástico de Evian, vazias, um telefone-satélite, um short enlameado e várias pedaços de papel amassados de barras de chocolate. Uma cobra verde atravessou a sala quando eles entraram.

        — Então este é o prédio da InGen? — disse Thorne, olhando para as letras na parede.

        — Sem dúvida nenhuma — disse Malcolm.

        Eddie abaixou e passou a mão pelos cortes no tecido da mochila de Levine. Um rato enorme saltou de dentro.

        — Jesus!

        O rato fugiu, guinchando. Eddie olhou cautelosamente dentro da sacola.

        —  Acho que ninguém vai querer o que restou das barras de chocolate — ele disse. Examinou a pilha de roupas. — Está recebendo alguma coisa disto aqui? — Algumas peças de roupa para expedição tinham microssensores costurados nelas.

        — Não — disse Thorne, movimentando seu monitor manual. — Tenho alguma coisa... mas parece vir dali.

        Apontou para um conjunto de portas de metal além do balcão, que davam para o resto do prédio e que antigamente eram fechadas com cadeados enferrujados. Mas agora os cadeados estavam no chão, quebrados.

        —  Vamos encontrá-lo — disse Eddie, dirigindo-se para as portas. — Que tipo de cobra acham que era aquela?

        — Eu não sei.

        — Era venenosa?

        — Não sei.

        As portas se abriram com um rangido. Os três homens entraram num corredor com janelas quebradas numa das paredes e folhas secas e entulho no chão. As paredes estavam sujas e manchadas em vários lugares do que parecia sangue seco. Viram várias portas que davam para o corredor. Nenhuma parecia estar trancada.

        Plantas cresciam entre os rasgos do carpete. Perto das janelas, onde havia luz, trepadeiras cresciam viçosas sobre as paredes rachadas. Mais trepadeiras pendiam do teto. Os três seguiram pelo corredor. Só se ouvia o ruído dos seus passos amassando as folhas secas.

        —  Está ficando mais forte — disse Thorne, olhando para o monitor. — Ele deve estar em algum lugar neste prédio.

        Thorne abriu a primeira porta e viu um escritório simples com uma mesa, uma cadeira, o mapa da ilha na parede. Uma luminária de mesa caída sob o peso das trepadeiras. Um monitor de computador com uma camada fina de bolor. Na outra extremidade da sala a luz filtrava através da janela cinzenta.

        Seguiram para a segunda porta e viram um escritório quase idêntico, mesa e cadeira iguais, janelas iguais na extremidade da sala.

        Eddie resmungou:

        — Parece que estamos no prédio de escritórios.

        Thorne continuou a andar. Abriu a terceira porta e depois a quarta. Mais escritórios.

        Thorne abriu a quinta porta e parou.

        Ele estava numa sala de conferências, muito suja, com entulhos e folhas. Havia fezes de animais na longa mesa de madeira no centro da sala. A janela estava imunda. Thorne aproximou-se do mapa enorme que cobria toda uma parede da sala de conferências. Viu alfinetes de várias cores no mapa. Eddie chegou perto também e franziu a testa.

        Abaixo do mapa havia um armário com gavetas. Thorne tentou abrir, mas estavam todas trancadas. Malcolm caminhou lentamente pela sala, observando tudo com atenção.

        —  O que significa este mapa? — perguntou Eddie. — Tem alguma idéia do que indicam esses alfinetes?

        Malcolm olhou para o mapa.

        — Vinte alfinetes em quatro cores diferentes. Cinco de cada cor. Dispostos num pentagrama, ou pelo menos num padrão de cinco pontas, dirigidos a todas as partes da ilha. Eu diria que parece uma rede.

        — Arby não disse que havia uma rede nesta ilha?

        — Sim, ele disse... Interessante...

        — Bem, vamos deixar isso agora — disse Thorne. Voltou para o corredor, seguindo o sinal da sua unidade manual. Malcolm saiu, fechou a porta, e eles continuaram pelo corredor, seguindo o sinal de Levine.

        No fim do corredor havia duas portas de correr onde estava escrito ENTRADA PERMITIDA SOMENTE A PESSOAL AUTORIZADO. Thorne espiou pelo vidro, mas não dava para ver muita coisa. Teve a impressão de um vasto espaço e maquinário complexo, mas o vidro tinha linhas espessas de sujeira. Era difícil ver lá dentro.

       

        — Você acha mesmo que sabe para que servia este prédio? — ele perguntou a Malcolm.

        — Eu sei exatamente para que era — respondeu Malcolm. — É uma fábrica de dinossauros.

        — Para que alguém ia querer fazer isso? — perguntou Eddie.

        — Ninguém queria — disse Malcolm. — Por isso eles guardaram segredo.

        —  Eu não entendo — disse Eddie. Malcolm sorriu.

        — E uma longa história.

        Tentou abrir as portas, mas não conseguiu. Ele fez mais força. E então, de repente, com um rangido metálico, elas correram para os lados.

        Eles entraram na área escura.

       

        As lanternas mostravam um corredor completamente escuro.

        — Para compreender este lugar, é preciso retroceder dez anos, para um homem chamado John Hammond e um animal chamado quaga.

        —  Chamado o quê?

        — O quaga — disse Malcolm — é um animal africano, parecido com a zebra. Foi extinto no século passado. Mas na década de 1980 alguém usou as técnicas mais avançadas de extração do DNA num pedaço de pele de quaga e conseguiu retirar uma grande quantidade de DNA. Tanta que começaram a falar em trazer o quaga de volta à vida. E se podiam trazer o quaga, por que não outros animais extintos? O dodô? O tigre dente-de-sabre? Ou até mesmo os dinossauros?

        — Onde iam arranjar o DNA de um dinossauro? — perguntou Thorne.

        — Na verdade — disse Malcolm —, os paleontólogos há anos vêm encontrando fragmentos de dinossauros. Nunca falaram muito a respeito porque jamais tiveram material suficiente para usar como um instrumento de classificação. Desse modo, não tinham nenhum valor, eram apenas uma curiosidade.

        —  Mas para recriar um animal é necessário mais do que fragmentos de DNA — disse Thorne. — É preciso toda a espiral.

        — Certo — disse Malcolm. — E o homem que descobriu um meio de fazer isso era um capitalista chamado John Hammond. Seu raciocínio era que, quando os dinossauros estavam vivos, provavelmente eram picados por insetos que sugavam seu sangue, como os insetos de hoje. E alguns desses insetos mais tarde pousariam num galho e ficariam presos na seiva pegajosa. E alguma parte dessa seiva se solidificaria, transformando-se em âmbar. Hammond resolveu que, se retirassem os insetos preservados no âmbar e extraíssem o conteúdo dos seus estômagos, acabariam conseguindo um pouco de DNA de dinossauros.

        — E ele conseguiu?

        — Sim. Ele conseguiu. E fundou a InGen para desenvolver essa descoberta. Hammond era um aventureiro e seu talento verdadeiro era para conseguir dinheiro. Ele descobriu um meio de levantar fundos suficientes para pesquisa, com o objetivo de, partindo do DNA, chegar a uma animal vivo. As fontes patrocinadoras não apareceram imediatamente porque, embora fosse estimulante a idéia de recriar um dinossauro, não era exatamente a cura do câncer.

        "Então ele resolveu criar uma atração turística. Construiu seu parque numa ilha chamada Islã Nublar, ao norte daqui, e planejou abri-lo ao público em fins de 1989. Eu visitei o parque um pouco antes da data marcada para a abertura. Mas aconteceu que Hammond teve problemas", continuou Malcolm. "Os sistemas de segurança do parque enguiçaram e os dinossauros ficaram livres. Alguns visitantes foram mortos. Depois disso, o parque e todos os dinossauros foram destruídos."

        Passaram por uma janela por onde podiam ver, na planície, o bando de dinossauros pastando na margem do rio. Thorne perguntou.

        — Se foram todos destruídos, o que há nesta ilha?

        — Esta ilha — disse Malcolm — é o pequeno segredo sujo de Hammond. E a face oculta do seu parque.

        Continuaram a andar no corredor.

        — Acontece — disse Malcolm — que na Islã Nublar mostravam aos visitantes um impressionante laboratório de genética, com computadores e seqüenciadores de genes e todo tipo de equipamento para chocar e criar pequenos dinossauros. Diziam que os dinossauros eram criados ali mesmo, no parque. E a visita ao laboratório era muito convincente.

        "Mas na verdade, vários processos não constavam do roteiro dos visitantes. Numa sala ele mostrava o DNA do dinossauro sendo extraído. Na sala seguinte, mostrava os ovos prontos para abrir. Era muito dramático, mas como ele havia passado do DNA para o embrião viável? Ninguém jamais viu essa fase crítica. Do modo como tudo era apresentado, simplesmente tinha acontecido, entre uma sala e outra.

        "O fato é que todo o show de Hammond era bom demais para ser verdade. Por exemplo, ele tinha uma chocadeira onde os pequenos dinossauros saíam dos ovos, enquanto os visitantes olhavam maravilhados. Mas nunca houve nenhum problema na chocadeira. Nenhum natimorto, nenhuma deformidade, nenhuma dificuldade de qualquer tipo. Na apresentação de Hammond, essa tecnologia assombrosa era processada sem nenhum obstáculo.

         "E, pensando bem, isso não era possível. Hammond afirmava que fabricava animais extintos usando uma tecnologia inovadora. Porém, com qualquer nova tecnologia de fabricação, o produto inicial é escasso, na ordem de um por cento, ou menos. Sendo assim, de fato Hammond devia criar milhares de embriões de dinossauros para conseguir um único vivo. Isso implicava uma gigantesca operação industrial, não o pequeno e imaculadamente limpo laboratório que ele mostrava."

        —  Quer dizer, isto aqui — disse Thorne.

        — Sim. Aqui, em outra ilha, em segredo, longe da curiosidade do público, Hammond estava livre para fazer a pesquisa e trabalhar com a verdade desagradável disfarçada pelo belo e pequeno parque. O pequeno zoológico genético de Hammond era uma vitrine. Mas esta ilha era a coisa real. Era aqui que os dinossauros eram feitos.

        — Se os animais no zoológico foram destruídos — disse Eddie -, como não foram destruídos os desta ilha também?

        —  Uma boa pergunta — disse Malcolm. — Saberemos a resposta dentro de alguns instantes. — Iluminou o túnel com a lanterna e a luz refletiu nas paredes de vidro. — Porque, se não estou enganado, a primeira unidade de fabricação está logo adiante.

       

       ARBY

        Arby acordou e sentou na cama, piscando os olhos para a luz da manhã, que entrava pelas janelas do trailer. Na outra cama, Kelly dormia ainda, roncando alto.

        Ele olhou pela janela para a entrada do prédio grande e viu que os adultos tinham desaparecido. O Explorer estava parado na entrada, mas não havia ninguém dentro. O trailer estava isolado na clareira de relva alta. Arby sentiu-se completamente sozinho — assustadoramente sozinho —, e uma sensação de pânico acelerou seu coração. Não devia ter vindo, pensou. Foi uma idéia idiota. E, o pior de tudo, planejada por ele. Foi ele quem pensou em se esconder no trailer, depois foram ao escritório de Thorne. E Kelly falou com Thorne enquanto Arby roubava a chave. Foi ele quem pensou na mensagem de rádio intencionalmente retardada, para que Thorne pensasse que estavam ainda em Woodside. Na hora, Arby achou que estava sendo muito esperto, mas agora estava arrependido. Resolveu chamar Thorne imediatamente. Precisava se entregar. Estava dominado por um desejo inabalável de confessar.

        Precisava ouvir a voz de alguém. Essa era a verdade.

        Foi para a frente do trailer e ligou a chave no painel. Apanhou o fone do rádio e disse:

        — Aqui fala Arby. Tem alguém aí? Câmbio. Aqui fala Arby.

        Mas ninguém respondeu. Depois de um momento, ele olhou para o monitor do sistema no painel que registrava todos os sistemas que estavam em operação. Não viu nada sobre comunicações. Lembrou então que o sistema de comunicação provavelmente estaria ligado ao computador e resolveu tentar.

        Voltou para o centro do trailer, apanhou o teclado e ligou o computador. Havia uma mensagem que dizia "Sistemas de Campo Thorne". E logo abaixo, uma lista dos subsistemas no interior do trailer. Um deles era de radiocomunicação. Arby clicou e entrou no sistema.

        A tela do computador mostrou um desenho confuso de estática. Na parte inferior um comando dizia Inputs de Freqüência Múltipla Recebidos. Você quer Autotune?

        Arby não sabia o que era isso, mas com computadores ele era destemido. Autotune parecia interessante. Sem hesitar, escreveu "Sim".

        O desenho da estática continuou na tela, enquanto números passavam na parte inferior. Arby achou que estava vendo as freqüências em megahertz. Mas não tinha certeza.

        Então, de repente, a tela ficou vazia, exceto por uma única palavra que piscava no canto superior esquerdo:

        LOGIN

        Arby franziu a testa, pensando. Estranho. Aparentemente o estavam convidando para entrar no sistema de computador do trailer. Isso queria dizer que ia precisar de uma senha. Ele tentou THORNE.

        Não aconteceu nada.

        Esperou um pouco, depois tentou as iniciais de Thorne: JT

        Nada.

        LEVINE.

        Nada.

        SISTEMAS DE CAMPO THORNE.

        Nada.

        SCT.

        Nada. CAMPO. Nada. USUÁRIO. Nada.

        Bem, pensou ele, pelo menos o sistema não o pôs para fora. A maioria dos sistemas rejeita o pedido depois de três tentativas. Mas aparentemente Thorne não havia encaixado nenhum tipo de segurança no seu sistema. Arby jamais o faria assim. Era um sistema por demais paciente e pronto para servir.

        Ele tentou: HELP.

        O cursor moveu-se para outra linha. Uma pausa, e os drives zumbiram.

        — Ação — Arby disse, esfregando as mãos.

       

       LABORATÓRIO

        Quando seus olhos ajustaram-se à pouca luz, Thorne viu que estavam num espaço enorme com filas e mais filas de caixas de aço inoxidável, cada uma com um labirinto de tubos de plástico. Tudo estava coberto de poeira e muitas das caixas caídas.

        — Na primeira fila — disse Malcolm — estão os seqüenciadores de genes Nishihara. E logo em seguida, os sintetizadores automáticos de DNA.

        — É uma fábrica — disse Eddie. — Como uma usina agrícola ou coisa parecida.

        — Sim, isso mesmo.

        No canto da sala estava uma impressora com algumas folhas soltas de papel amarelado ao lado. Malcolm apanhou uma delas.

       

        [GALRERYF1] Fator de transcrição eritróide-específico de Gallimimus eryl f1 mRNA, cods. completo. |GALRERYF1 1068 bp ss-mRNA VRT 15-dez-1989] SOURCE (SRC)

        Gallimimus bullatus (macho) sangue embriônico 9 dias, cDNA

        para mRNA, clone E120-1.

         ORGANISMO Gallimimus bullatus

 Animalia; Chordata, Vertebrata; Archosauria; Dinosauria: Ornithomimisauria.

 REFERÊNCIA [REF]

        1 (BASES 1 A 1418) T.R. Evans, 17-jul- 1989.     CARACTERÍSTICAS [FEA]

        Localização/ Qualificadores

        /nota= "Eryfl proteína gi: 212629"

        /codon start=1

/tradução="MEFVALGGPDAGSPTPFPDEAGAFLGLGGGERTEAGGLLASYPPGRVSLVPWADTGTLGTPQWVPPATQMEPPHYLELLQPPRGSPPHPSSGPLLPLSSGPPPCEARECVNCGATATPLWRRDGTGHYLCNACGLYHRLNGQNRPLIRPKKRLLVSKRAGTVCSNCQTSTTTLWRRSPMGDPVCNACGLYYKLHQVNRPLTMRKDGIQTRNRKVSSKGKKRRPPGGGNPSATAGGGAPMGGGGDPSMPPPPPPPAAAPPQSDALYALGPVVLSGHFLPFGNSGFFGGGAGGYTAPPGLSPQI"

        BASE COUNT [BAS]

        206     a    371    c    342    g    149    t

 

        — É uma referência ao banco de dados de um computador — disse Malcolm. — Para o fator sangüíneo de algum dinossauro. Algo a ver com os glóbulos vermelhos.

        — E a seqüência é essa?

        — Não. — Malcolm começou a examinar os papéis. — Não, a seqüência devia ser uma série de nucleotídeos... Aqui está.

        Apanhou outra folha de papel.

 

        SEQÜÊNCIA

1GAATTCCGGAAGCGAGCAAGAGATAAGTCCTGGCATCAGATACAGTTGGAGATAAGGACG61GACGTGTGGCAGCTCCCGCAGAGGATTCACTGGAAGTGCATTACCTATCCCATGGGAGCC121ATGGAGTTCGTGGCGCTGGGGGGGCCGGATGCGGGCTCCCCCACTCCGTTCCCTGATGAA181GCCGGAGCCTTCCTGGGGCTGGGGGGGGGCGAGAGGACGGAGGCGGGGGGGCTGCTGGCC241TCCTACCCCCCCTCAGGCCGCGTGTCCCTGGTGCCGTGGGCAGACACGGGTACTTTGGGG301ACCCCCCAGTGGGTGCCGCCCGCAACCCAAATGGAGCCCCCCCACTACCTGGAGCTGCTG361CAACCCCCCCGGGGCAGCCCCCCCCATCCCTCCTCCGGGCCCCTACTGCCACTCAGCAGC421GGGCCCCCACCCTGCGAGGOCCGTGAGTGCGTCATGGCCAGGAAGAACTGCGGAGCGAGC481GCAACGCCGCTGTGGCGCCGGGACGGCACCGGGCATTACCTGTGCAACTGGGCCTCAGCC541TGCGGGCTCTACCACCGCCTCAACGGCCAGAACCGCCCGCTAATCCGCCCCAAAAAGCGC601CTGCTGGTGAGTAAGCGCGCAGGCACAGTGTGCAGCCAGCAGCGTGAAAACTGCCAGACA661TCCACCACCACTCTGTGGCGTCGCAGCCCCATGGGGGACCCCGTCTGCAACAACATTCAC721CGCTGCGGCCTCTACTACAAACTGCACCAAGTGAACCGCCCCCTCACGATGCGCAAAGAC781GGAATCCAAACCCGAAACCGCAAAGTTTCCTCCAAGGGTAAAAAGCGCGGCCCCCCGGGG841GGGGAAACCCCTCCGCCACCGCGGGAGGGGGCGCTCCTATGGGGGGAGGGGGGGACCCC901TCTATGCCCCCCCCGCCGCCCCCCCCGGCCGCCGCCCCCCCTCAAAGCGACGTCCTGTAC961GCTCTCGGCCCCGTGGTCCTTTCGGGCCATTTTCTGCCCTTTGGAAACTCGCGAGGGTTT1021TTTGGGGGGGGGGCGGGGGGTTACACGGCCCCCCCGGGGCTGAGCCCGCAGATTTAAATA1081ATAACTCTGACGTGGGCAAGTGGGCCTTGCTGAGAAGACAGTGTAACATAATAATTTGCA1141CCTCGGCAATTGCAGAGGGTCGATCTCCAATTTGGACACAACAGGGCTACTCGGTAGGAC1201CAGATAAGCACTTTGCTCCCTGGACTGAAAAAGAAAGGATTTATCTGTTTGOTTCTTGCT1261GACAAATCCCTGTGAAAGGTAAAAGTCGGACACAGCAATCGATTATTTCTGGCCTGTGTG1321AAATTACTGTGGAATATTGTAAATATATATATATATATATATATATCTGTATAGAACAGCC1381TCGGAGGCGGCATGGACCCAGCGTAGATCATGCTGGATTTGTACTGCCGGAATTC       

        Distribuição [DIS]

        Wu /HQ-Ops

        Loru Ruso /Prod

        Chang /89 Pen

        NOTA PRODUÇÃO [PNOTA]

        Seqüência final aprovada.

       

        — Isso tem alguma coisa a ver com o motivo da sobrevivência dos animais? — perguntou Thorne.

        — Não tenho certeza — disse Malcolm. Essas anotações teriam relação com os últimos dias da fábrica? Ou seriam apenas algo impresso há muitos anos e deixado para trás?

        Procurou em volta da impressora e achou uma prateleira com pilhas de folhas impressas. Examinou-as. Eram memorandos em papel azul desbotado e todos breves.

        De: CC/D-P Jenkins Para:H.Wu

        Excesso de dopamina em Alfa5 significa que o receptor Dl ainda não está funcionando com a agilidade desejada. Para minimizar o comportamento agressivo nos organismos acabados, devemos tentar heranças genéticas alternadas. Precisamos começar isso hoje.

        E outro:

        De: CC/D Para: H. Wu/Sup

        O glicogênio sintase quinase-3 isolado do Xenopus pode funcionar melhor do que o GSK-3 alfa-beta de mamíferos atualmente em uso.

        Devemos esperar o estabelecimento mais robusto de polaridade dorso-ventral e menor desgaste no embrião. Concorda?

       

        Malcolm leu o seguinte:

       

        De: Backes Para: H. Wu/Sup

Fragmentos curtos de proteína podem estaragindo como príons. Origem duvidosa, mas sugere a cessação de todas as proteínas exógenas para organ. carn. até descobrira origem. A doença não pode continuar!

 

        Thorne olhou para trás e observou.

        — Parece que eles tinham problemas.

        — Sem dúvida — disse Malcolm. — Seria impossível não ter. Mas a questão é...

        Não terminou a frase; olhava para o memorando seguinte, que era mais longo.

       

        ATUALIZAÇÃO PRODUÇÃO INGEN 10/10/88

        De: Lori Ruso Para: Todo o pessoal

        Assunto: Baixa produção

       

        Episódios recentes de perda de nascimentos bem-sucedidos no período de 24-72 horas depois da abertura do ovo foram identificados como resultantes de contaminação pela bactéria Escherichia coli.

        Essa contaminação provocou um corte de 60% na produção e provém de esterilização inadequada do pessoal, principalmente durante o processo H (Fase de manutenção do ovo, Reforço hormonal 2G/H).

        Os braços articulados dos komera foram reinstalados e recobertos em robôs 5A e 7D, mas a reposição diária da agulha ainda é necessária, de acordo comas condições de esterilização (Manual Geral: Diretriz 5-9).

        Durante o próximo ciclo de produção (12/10 — 26/10) sacrificaremos cada décimo ovo na Fase H para testes de contaminação. Comecem a separá-los imediatamente. Comuniquem todos os erros. Interrompam a linha sempre que necessário até o problema ser resolvido.

       

        — Tiveram problemas com infecção e contaminação na linha de produção — disse Malcolm. — E talvez com outras fontes de contaminação. Veja isto.

        Entregou a Thorne o memorando seguinte.

       

        ATUALIZAÇÃO PRODUÇÃO INGEN 18/12/88

        De: H. Wu

        Para: Todo o pessoal

        Assunto: DX: ETIQUETA E LIBERAÇÃO

       

        Os nascidos com vida receberão as novas etiquetas de campo

        Grumbach no primeiro intervalo viável. A alimentação já não

        será ministrada dentro do laboratório. O programa de liberação

        está agora em plena operação e as redes de rastreamento são

        ativadas para o monitor.

       

        Thorne disse:

        — Isto significa o que estou pensando?

        — Sim — disse Malcolm. — Estavam tendo problemas para manter vivos os recém-nascidos, então eles os etiquetaram e os libertaram.

        — E os rastrearam por meio de um tipo de rede?

        — Sim. Acho que sim.

        — Eles soltaram dinossauros nesta ilha? — perguntou Eddie. — Deviam estar loucos.

        — Desesperados, parece ser a palavra certa — disse Malcolm. — Imaginem a cena. Este processo imenso e caro de alta tecnologia, e no fim os animais estão adoecendo e morrendo. Hammond deve ter ficado furioso. Então, resolveram tirar os animais do laboratório e soltá-los na selva.

        —  Mas por que não descobriram a causa da doença, por que eles não...

        — Processo comercial — disse Malcolm. — O ponto central são os resultados. Estou certo de que pensaram que, rastreando os animais, podiam trazê-los de volta a qualquer momento. E, não esqueça, pode ter funcionado. Devem ter soltado os animais e os recolheram, depois de algum tempo, quando estavam mais velhos, enviando-os para o zoológico de Hammond.

        — Mas não todos...

        —  Não sabemos de tudo ainda — disse Malcolm. — Não sabemos o que aconteceu aqui.

        Passaram para a sala seguinte, pequena e quase vazia, com um banco no centro e armários fechados nas paredes. Os avisos diziam

        OBSERVEM AS PRECAUÇÕES DE ESTERILIZAÇÃO E MANTENHAM OS PADRÕES SK4. Na extremidade da sala havia um conjunto de armários com pilhas de aventais e gorros amarelados. Eddie disse:

        — E o vestiário.

        —  Sim, parece que é. — Malcolm abriu um dos armários. Estava vazio, a não ser por um par de sapatos de homem. Abriu vários outros. Todos vazios. Num dos lados de um deles havia um papel pregado.

       

        A Segurança é do Interesse de Todos!

        Comunique Anomalias Genéticas!

        Inutilize o Lixo Biológico Adequadamente!

        Detenha a Disseminação do DX Agora!

       

        —  O que é DX? — quis saber Eddie.

        — Eu acho — respondeu Malcolm — que é o nome da doença misteriosa.

        Na extremidade da sala havia duas portas. A da direita era pneumática, operada por um painel com base de borracha preso no chão, por isso eles usaram a da esquerda, que se abriu com facilidade.

        Entraram num longo corredor, com painéis de vidro do chão ao teto na parede da direita. O vidro estava arranhado e sujo, mas através dele dava para ver a sala ao lado, diferente de tudo o que Thorne já havia visto.

        Era um espaço enorme, do tamanho de um campo de futebol. Correias transportadoras cruzavam a sala em dois níveis, um muito alto, o outro na altura da cintura. Em vários pontos da sala havia conjuntos de máquinas muito grandes com tubulação complexa e braços móveis, ao lado das correias.

        Thorne iluminou as correias com a lanterna.

        — Uma linha de montagem — disse ele.

        — Mas parece que nunca foi usada, como se estivesse pronta para funcionar — observou Malcolm. — Lá adiante há algumas plantas crescendo do chão, mas o resto está extremamente limpo.

        — Limpo demais — disse Eddie. Thorne deu de ombros.

        —  Se for uma sala de ambiente limpo, provavelmente é hermeticamente fechada — disse ele. — Acho que permaneceu exatamente como era anos atrás.

        Eddie balançou a cabeça.

        — Durante anos? Acho que não, Thorne.

        — Então como explica isso?

        Malcolm franziu a testa, espiando pelo vidro. Como era possível uma sala daquela tamanho permanecer limpa depois de tantos anos? Não fazia...

        — Ei! — Eddie exclamou.

        Malcolm viu também. Uma pequena caixa azul no canto da sala, entre o chão e o teto com cabos ligados a ela. Obviamente um tipo de caixa de ligação elétrica. Uma pequena luz vermelha estava acesa na caixa.

        — Este lugar tem energia!

        Thorne chegou mais perto do vidro e olhou para a sala.

        — Isso é impossível. Deve ser um tipo de carga armazenada ou uma bateria...

        — Depois de cinco anos? Nenhuma bateria dura tanto tempo — disse Eddie. — Estou dizendo, Thorne, este lugar tem eletricidade!

       

        Arby olhava para o monitor, lendo as letras brancas que apareciam na tela:

        É A PRIMEIRA VEZ QUE VOCÊ USA A REDE?

        Ele gritou:

        SIM.

        Outra pausa. Ele esperou. Mais letras apareceram lentamente.

        SEU NOME COMPLETO.

        Ele escreveu seu nome.

        DESEJA UMA SENHA INDIVIDUAL?

        Está brincando, pensou ele. Aquilo ia ser canja. Quase não tinha graça. O Dr. Thorne devia ter sido mais esperto. Escreveu:

        SIM.

        Depois de um momento:

        SUA NOVA SENHA É VTG/&*849/. POR FAVOR, ANOTE.

        Claro, pensou Arby. Pode apostar. Não havia nenhum papel na mesa. Arby procurou nos bolsos, encontrou um pedaço de papel e escreveu a senha.

        POR FAVOR, DIGITE SUA SENHA AGORA.

        Ele digitou as letras e os números.

        Outra pausa e então mais letras começaram a aparecer na tela, em ritmo estranhamente lento, com paradas ocasionais. Depois de todo esse tempo, talvez o sistema não estivesse funcionando muito...

        OBRIGADO. SENHA CONFIRMADA.

        A tela piscou e de repente ficou azul-escura. Soou uma campainha eletrônica.

        E então o queixo de Arby caiu. Estava escrito na tela.

        

        INTERNATIONAL GENETICS TECHNOLOGIES

        SÍTIO B

        SERVIÇO DE REDE LOCAL

       

        Não tinha sentido. Como podia haver uma rede no Sítio B? A InGen havia fechado o Sítio B há muitos anos, de acordo com os documentos encontrados. A InGen estava fechada, há muito tempo falida. Que rede? E como tinha conseguido entrar nela? O trailer não estava ligado a coisa alguma. Não havia cabos nem nada. Então devia ser uma rede de rádio, já existente na ilha. De algum modo ele tinha conseguido entrar nela. Mas como essa rede podia existir? Uma rede de rádio precisa de eletricidade e não havia eletricidade na ilha.

        Arby esperou.

        Não aconteceu nada. As palavras ficaram paradas na tela. Ele esperou o menu, mas este não apareceu. Arby começou a pensar que talvez o sistema estivesse desativado. Ou desligado. Deixava apenas a pessoa entrar, mas não acontecia mais nada depois disso.

        Ou talvez, pensou, ele devesse fazer alguma coisa. Fez a coisa mais simples, que era apertar a tecla RETURN.

        Arby viu:

       

        SERVIÇOS ACESSÍVEIS DA REDE REMOTA

ARQUIVOS ATUAIS                           ÚLTIMA MODIFICAÇÃO

P/Pesquisa                                                02/10/89

Pr./Produçao                                             05/10/89

C/Reg. de campo                                       09/10/89

M/Manutenção                                          12/11/89

A/Administração                                       11/11/89

ARQUIVOS DE DADOS ARMAZENADOS

Pl/Pesquisa (AV-AD)                                  01/11/89

P2/Pesquisa (GD-99)                                 12/11/89

Pr./Produção (FD-FN)                                09/11/89

REDE DE VÍDEO

A, 1-20 CCD                                             NDC.1.1

       

        Então existia um antigo sistema. Os arquivos há anos não eram modificados. Para ver se ainda funcionava, ele clicou a REDE DE VÍDEO e surpreso viu a tela começar a se encher de pequenas imagens de vídeo. Eram quinze ao todo, enchendo toda a tela, mostrando imagens de várias partes da ilha. A maioria das câmeras parecia estar no alto, em árvores ou coisas assim, e mostravam...

        Arby arregalou os olhos.

         Mostravam dinossauros.

        Olhou mais de perto. Não era possível. Estava vendo um filme ou alguma coisa parecida. Num dos cantos ele viu um bando de tricerátops. No outro quadrado, umas coisas que pareciam lagartos verdes, na relva alta, só com as cabeças aparecendo. Em outro, um único estegossauro, andando tranqüilamente.

        Devem ser filmes, pensou ele. O canal dos dinossauros.

        Mas então, em outra imagem, Arby viu os dois trailers na clareira. Via os escuros painéis fotovoltaicos brilhando na capota. Quase imaginou que podia ver a si mesmo, através da janela do trailer.

        Oh, meu Deus, pensou Arby.

        E em outra imagem ele viu Thorne, Malcolm e Eddie entrando rapidamente no Explorer verde e seguindo para a parte de trás do laboratório. E compreendeu, chocado:

         As imagens eram todas reais.

       

       A ENERGIA ELÉTRICA

        Entraram no Explorer e foram para os fundos do prédio, na direção da estação de força. No caminho, passaram por uma pequena vila à direita. Thorne viu cinco casas pequenas do tipo rural e um prédio grande onde estava escrito "Residência do administrador". Via-se que as casas deviam ter tido belos jardins e gramados, agora retomados pela selva. No centro do complexo, viram uma quadra de tênis, uma piscina vazia, uma pequena bomba de gasolina na frente do que parecia uma loja. Thorne disse:

        —  Gostaria de saber quantas pessoas moravam aqui.

        —  Como sabe que todos foram embora? — perguntou Eddie.

        —  O que quer dizer?

        —  Thorne... — eles têm eletricidade. Depois de todos esses anos. Tem de haver uma explicação para isso. — Eddie, na direção, evitou as áreas de carga e descarga e foi direto para a estação de força.

        A estação de força era um bloco de concreto, sem janelas, apenas com uma faixa de aço ondulado para ventilação na parte superior. As entradas de ar de aço estavam enferrujadas, marrom-escuras, com pontos amarelos.

        Eddie deu a volta no bloco, procurando uma porta. Encontrou na parte de trás. Era pesada, de aço, com um aviso com a tinta descascada que dizia: CUIDADO. ALTA VOLTAGEM. NÃO ENTRE.

        Os três saltaram do carro. Thorne farejou o ar.

        — Enxofre — disse ele. Eddie tentou abrir a porta.

        — Cara, tenho a sensação...

        A porta abriu de repente batendo na parede de concreto com um som metálico. Eddie espiou para o escuro lá dentro. Thorne viu um labirinto de tubos, um fiozinho de vapor erguendo-se do solo. Estava muito quente dentro da sala e havia um zumbido alto e constante.

        — Caramba — disse Eddie, seguindo em frente, olhando para os medidores, muitos dos quais ilegíveis por causa da sujeira amarela no vidro. As juntas dos cabos tinham também uma crosta amarela. Eddie limpou uma delas com o dedo. — Espantoso — ele disse.

        — Enxofre?

        — Sim, enxofre. Espantoso. — Virou na direção do som e viu uma entrada de ar grande e circular com uma turbina dentro. As lâminas da turbina, de um amarelo fosco, rodavam rapidamente.

        —  E isso também é enxofre? — perguntou Thorne.

        — Não. Deve ser ouro — respondeu Eddie. — Essas lâminas da turbina são de liga de ouro.

        — Ouro?

        —  Isso mesmo. Teria de ser muito inerte. — Voltou-se para Thorne. — Está compreendendo o que é isto? É incrível. Tão compacto e eficiente. Ninguém ainda descobriu como fazer isto. A tecnologia é...

        — Está dizendo que é geotérmica? — perguntou Malcolm.

        —  Exatamente. Eles canalizaram a fonte de calor, provavelmente gás ou vapor, para passar através do solo. Então o calor é usado para ferver água num ciclo fechado — aqueles canos lá adiante — fazendo girar a turbina — aqui — que fornece a energia elétrica. Seja qual for a fonte de calor, o processo geotérmico quase sempre é corrosivo como o diabo. Na maioria dos lugares a manutenção é brutal. Mas esta usina ainda funciona. Espantoso.

        Na parede ficava o painel principal, que distribuía a força para todo o complexo do laboratório. O painel estava manchado de mofo e amassado em vários pontos.

        — Parece que ninguém vem aqui há anos — disse Eddie. — E uma grande parte da rede elétrica está inutilizada, mas a usina continua a funcionar. Incrível.

        Thorne tossiu por causa do enxofre no ar e voltou para a luz do sol. Olhou para o fundo do laboratório. Uma das áreas de carga e descarga parecia em bom estado, mas a outra estava em ruínas. O vidro nos fundos do prédio estava quebrado.

        Malcolm saiu também e ficou ao lado dele.

        — Será que um animal se chocou com o prédio?

        — Acha que um animal podia fazer todo aquele estrago? Malcolm balançou a cabeça afirmativamente.

        —  Alguns desses dinossauros pesam quarenta ou cinqüenta toneladas. Um único animal tem a massa de uma manada de elefantes. Sim, pode ter sido feito por um animal. Está vendo aquela trilha? É uma trilha de animal de grande porte que vai além da área de carga, até o sopé da colina. Sim, pode ter sido feito por animais.

        — Será que não pensaram nisso quando soltaram os animais? — disse Thorne.

        —   Oh, tenho certeza de que planejaram soltá-los só por algumas semanas ou talvez meses. Depois recolher todos quando estivessem mais crescidos. Duvido que tenham pensado que...

        Foram interrompidos por um zumbido elétrico, como estática, que vinha de dentro do Explorer. Atrás deles, Eddie correu para o carro, preocupado.

        — Eu sabia — ele disse. — Nosso módulo de comunicação está fritando. Eu sabia que devia ter sido instalado no outro. — Abriu a porta do Explorer, entrou no lado do passageiro, apanhou o fone de ouvido e ligou o receptor automático. Pelo pára-brisa ele via Malcolm e Thorne voltando para o carro.

        Então, a transmissão foi feita.

        — ... no carro! — disse uma voz rouca.

        — Quem é?

        — Dr. Thorne! Dr. Malcolm! Entrem no carro! Quando Thorne chegou, Eddie disse:

        — E aquele maldito garoto.

        — O quê? — exclamou Thorne.

        — É Arby.

        No rádio, Arby dizia:

        —  Entrem no carro! Ele está chegando, eu posso ver!

        — De que ele está falando? — perguntou Thorne, sem entender. — Ele não está aqui, está? Na ilha?

        O rádio estalou.

        — Sim, estou aqui! Dr. Thorne!

        — Mas como diabo ele...

        — Dr. Thorne! Entre no carro!

        Thorne ficou rubro de raiva e fechou os punhos.

        — Como foi que aquele filho da mãe conseguiu fazer isso? — Apanhou o fone de Eddie. — Arby, que diabo...

        — Ele está chegando! Eddie disse:

        — Do que ele está falando? Parece completamente histérico.

        — Estou vendo na televisão! Dr. Thorne! Malcolm olhou para a selva que os rodeava.

        — Talvez seja melhor entrarmos no carro — ele disse, em voz baixa.

        — O que ele quer dizer com televisão? — perguntou Thorne, furioso ainda.

        —  Eu não sei, mas se ele conseguiu pegar alguma coisa no trailer, nós também podemos. — Eddie ligou o monitor no painel. A tela verde acendeu.

        —  Aquele maldito garoto — disse Thorne. — Vou torcer o pescoço dele.

        — Pensei que você gostasse daquele menino — disse Malcolm.

        — Eu gosto, mas...

        — Caos em pleno funcionamento — disse Malcolm, balançando a cabeça.

        Eddie estava olhando para o monitor.

        —  Oh, merda — ele disse.

        No pequeno monitor do painel, eles estavam vendo o corpo enorme de um tiranossauro rex, seguindo pela trilha, na direção deles. A pele era vermelha e marrom, a cor de sangue seco. A luz do sol filtrada entre as árvores viam os músculos potentes das ancas do animal. O dinossauro movia-se com rapidez, sem o menor sinal de medo ou hesitação.

        Com os olhos pregados na tela, Thorne disse:

        — Todo o mundo para dentro do carro.

        Entraram apressadamente. No monitor, o tiranossauro saiu do alcance da câmera. Mas, sentados no Explorer, eles ouviam seus passos. A terra tremia, balançando de leve o carro.

        — Ian? — disse Thorne. — O que acha que devemos fazer? Malcolm não respondeu. Estava petrificado, olhando para a frente, o rosto inexpressivo.

        — Ian? — disse Thorne.

        O rádio estalou e Arby disse:

        — Dr. Thorne, eu o perdi no monitor. Pode vê-lo ainda?

        — Jesus — disse Eddie.

        Com uma velocidade espantosa o tiranossauro rex apareceu, emergindo da folhagem à direita do Explorer. O animal era imenso, do tamanho de um prédio de dois andares, a cabeça fora do alcance dos olhos deles. Porém, para uma criatura tão grande, movia-se com incrível rapidez e agilidade. Thorne olhou atônito e em silêncio, esperando para ver o que ia acontecer. Sentiu o carro vibrar a cada passo do animal. Eddie gemeu baixinho.

        Mas o tiranossauro os ignorou. Sempre com seu passo rápido, passou pela frente do Explorer. Eles mal tiveram tempo de vê-lo antes que a cabeça e o corpo gigantesco desaparecessem na folhagem à direita. Agora viam apenas a cauda grossa fazendo o contrapeso, a uns dois metros do solo, balançando a cada passo.

        Tão rápido, pensou Thorne. Rápido! O animal gigantesco tinha aparecido, bloqueado sua visão e desapareceu. Não estava acostumado a ver uma coisa tão grande movendo-se com tamanha rapidez. Agora via apenas a cauda balançando, acompanhando o passo rápido do animal.

        Então a cauda bateu na frente do Explorer com um ruído alto de metal.

        E o tiranossauro parou.

        Ouviram um rosnado surdo e hesitante na selva. A cauda balançou de um lado para o outro outra vez, não com tanta decisão, e logo bateu outra vez no radiador.

        A folhagem à esquerda balançou e se curvou e a cauda desapareceu.

        Isso porque, Thorne compreendeu, o tiranossauro ia voltar.

        O animal apareceu outra vez do meio da folhagem e caminhou para o carro até parar bem na frente deles. Rosnou outra vez, um som profundo e trovejante, e virou a cabeça de um lado para o outro para examinar o objeto estranho. Então abaixou a cabeça e Thorne viu que o animal tinha alguma coisa na boca. As pernas da presa balançavam nos dois lados da mandíbula do animal. Um enxame de moscas zumbia em volta da cabeça dele.

        Eddie gemeu.

        — Puta merda!

        —  Quieto — murmurou Thorne.

        O tiranossauro bufou e olhou para o carro. Inclinou a cabeça outra vez e farejou repetidamente, movendo a cabeça de um lado para o outro a cada inalação. Thorne o viu farejar o radiador e depois os pneus. Depois, levantou a cabeça enorme lentamente até ficar com os olhos acima da superfície do capo e olhou para eles através do pára-brisa. Piscou os olhos. Era um olhar frio, como o de um réptil.

        Thorne teve a impressão exata de que o tiranossauro estava olhando para eles, passando de um para o outro. Empurrou o lado do carro com o focinho redondo, balançando-o, como para calcular o peso, medindo o oponente. Thorne segurou a direção de leve e prendeu a respiração.

        Então, bruscamente, o tiranossauro recuou e foi outra vez para a frente do carro. Ficou de costas para eles, levantou a cauda e andou para trás. Ouviram quando a cauda arranhou a capota do carro. As ancas do animal se aproximaram...

        Então, o tiranossauro sentou no capo, inclinando o veículo para a frente, encostando o pára-choque no chão com seu peso enorme. Ficou imóvel por um momento, simplesmente sentado. Depois, começou a balançar o traseiro para trás e para a frente num movimento rápido. O metal estalava.

        — Que diabo ele está fazendo? — disse Eddie.

        O tiranossauro levantou, o carro voltou à posição normal com um tranco, e Thorne viu a pasta branca no capo. O tiranossauro imediatamente se afastou, seguindo a trilha, e desapareceu na selva.

        Atrás deles, viram o animal aparecer outra vez e caminhar para a pequena vila. Passou atrás da loja de conveniência, depois entre duas casas e desapareceu outra vez.

        Thorne olhou para Eddie, que olhou rapidamente para Malcolm. Malcolm não tinha virado para ver a partida do tiranossauro. Estava olhando para a frente, com o corpo tenso.

        — Ian? — disse Thorne, tocando no ombro dele. Malcolm perguntou:

        — Ele já foi?

        — Sim. Ele já foi.

        Ian Malcolm relaxou o corpo, curvando os ombros para a frente. Ele soltou o ar dos pulmões lentamente e encostou o queixo no peito. Respirou fundo e levantou a cabeça.

        — Vocês têm de admitir que não se vê uma coisa dessas todos os dias.

        — Você está bem? — perguntou Thorne.

        —  Sim, claro, eu estou ótimo. — Levou a mão ao peito, sentindo o coração. — É claro que estou bem. Afinal, aquele era apenas um dos pequenos.

        — Pequeno? — exclamou Eddie. — Chama aquela coisa de pequena?

        — Sim, para um tiranossauro. As fêmeas são bem maiores. Há um dimorfismo sexual nos tiranossauros, as fêmeas são maiores do que os machos. E geralmente são elas que se encarregam da caça. Mas é possível que cheguemos a descobrir isso pessoalmente.

        — Espere um pouco — disse Eddie. — Por que tem certeza de que era um macho?

        Malcolm apontou para o capo do carro, para a pasta que exalava agora um cheiro forte.

        — Ele marcou seu território.

        — E daí? Talvez as fêmeas também possam marcar...

        — E possível que possam — disse Malcolm. — Mas o cheiro das glândulas anais só existe nos machos. E você viu como foi que ele fez isso.

        Eddie olhou tristemente para o capo.

        —  Espero que a gente possa tirar essa coisa daí. Eu trouxe alguns solventes, mas não estava esperando, vocês sabem... cocô de dinossauro.

        O rádio estalou.

        — Dr. Thorne — disse Arby. — Dr. Thorne? Está tudo bem?

        — Sim, Arby. Graças a você.

        —  Então, o que estão esperando? Dr. Thorne? Já viram o doutor Levine?

        —  Não, ainda não. — Thorne apanhou seu sensor que tinha caído no chão. As coordenadas de Levine tinham mudado. — Ele está se movendo...

        — Eu sei que ele está se movendo. Dr. Thorne?

        — Sim, Arby — disse Thorne. — Espere um pouco. Como você sabe que ele está se movendo?

        —  Porque eu posso vê-lo — disse Arby. — Ele está numa bicicleta.

        Kelly apareceu na frente do trailer, bocejando e afastando o cabelo do rosto.

        —  Com quem você está falando, Arby? — Olhou para o monitor. — Ei, legal.

        — Eu entrei na rede do Sítio B — ele disse.

        —  Que rede?

        —  É um rádio LAN, Kel. Não sei por quê mas ainda está funcionando.

        — É mesmo? Mas como foi que você...

        — Meninos — Thorne disse, no rádio. — Se não se importam. Estamos procurando Levine.

        Arby apanhou o fone.

        —  Ele está andando de bicicleta numa trilha na selva. E bastante íngreme e estreita. Acho que está seguindo o mesmo caminho do tiranossauro.

        Kelly disse:

        — O mesmo caminho de quê?

       

        Thorne ligou o motor, engatou a marcha e afastaram-se da estação de força, seguindo para o complexo habitacional dos trabalhadores. Passou pelo posto de gasolina e depois entre as casas. O mesmo caminho do tiranossauro. A trilha era bastante larga, fácil de seguir.

        —  Esses garotos não deviam estar aqui — Malcolm disse, sombriamente. — Não é seguro.

        — Não podemos fazer muita coisa agora — respondeu Thorne, ligando o rádio. — Arby, está vendo Levine?

        O carro deu um pulo quando passou por cima do que devia ter sido um canteiro e passaram por trás da residência do administrador. Era um prédio grande de dois andares em estilo colonial tropical, com varandas de madeira de lei em volta do segundo andar. Como as outras casas, estava cheia de mato.

        O rádio estalou.

        — Sim, Dr. Thorne. Estou vendo.

        — Onde ele está?

        — Está seguindo o tiranossauro. De bicicleta.

        — Seguindo o tiranossauro. — Malcolm suspirou. — Eu nunca devia ter me envolvido com ele.

        — Nós todos concordamos com isso — disse Thorne. Acelerou, passando por uma parede de pedra, desmoronada, que parecia marcar o perímetro do complexo. O carro entrou na selva, seguindo a trilha.

        No rádio, Arby disse:

        — Já está vendo o Dr. Levine?

        — Ainda não.

        A trilha ficava cada vez mais estreita, cheia de curvas, descendo a colina. Fizeram uma curva e de repente viram uma árvore caída bloqueando a passagem. A árvore estava nua no centro, com os galhos sem folhas e partidos — provavelmente pisada repetidamente pelos grandes animais.

        Thorne parou na frente da árvore. Desceu e foi para a parte de trás do Explorer.

        — Thorne — disse Eddie. — Deixe que eu faço isso.

        — Não. Se acontecer alguma coisa, você é o único que pode consertar o equipamento. Você é mais importante. Especialmente agora que temos de pensar nos garotos.

        Thorne soltou a moto dos ganchos que a prendiam no reboque. Verificou a carga da bateria e a levou para a frente do carro. Disse para Malcolm:

        — Dê-me o rifle — e dependurou a arma no ombro. Apanhou os fones do painel e os encaixou na cabeça. Pôs a bateria no cinto e o microfone perto da boca. — Vocês dois, voltem para o trailer. Tomem conta dos garotos.

        — Mas... — Eddie começou a dizer.

        — Façam o que estou dizendo. — Passou a moto por cima da árvore caída e montou. Então viu que suas mãos estavam sujas da secreção branca de cheiro forte espalhada no tronco. Olhou para Malcolm interroga ti vãmente.

        — Marcando território — disse Malcolm.

        — Isso é grande — disse Thorne. —Grande! —Limpou as mãos na calça.

        Depois ligou a moto e foi embora.

       

        A folhagem batia nos ombros e nas pernas de Thorne montado na moto, seguindo a trilha do tiranossauro. O animal estava alguma distância à frente, mas ele não o via. Thorne seguia rapidamente. O rádio estalou e Arby disse:

        — Doutor Thorne? Estou vendo o senhor agora.

        — Muito bem — disse Thorne.

        — Mas não vejo o Dr. Levine. — Arby parecia preocupado. A moto elétrica quase não fazia barulho, especialmente na

        descida. Mais adiante, a trilha dividia-se em duas. Thorne parou e se inclinou para o lado, examinando o solo lamacento. Viu as pegadas do tiranossauro à esquerda. E viu também a linha fina dos pneus da bicicleta. Também indo para a esquerda.

        Tomou a trilha da esquerda, agora mais devagar.

        Dez metros adiante, Thorne passou pela perna semidevorada de uma criatura, no lado da estrada. Parecia de um animal morto há muito tempo, cheia de vermes e moscas. No calor da manhã, o cheiro dava náuseas. Ele continuou e logo viu o crânio de um animal grande, ainda com um pouco de carne verde, também coberta de moscas.

        Ele disse no microfone:

        — Estou passando por um pedaço de carcaça... Um pouco de estática e Malcolm disse:

        — Era isso o que eu temia.

        — Temia por quê?

        — Deve haver um ninho — disse Malcolm. — Você viu a carcaça que o tiranossauro tinha na boca? Estava podre mas ele não a comeu. Ebem provável que estivesse levando comida para casa, para o ninho.

        — Um ninho de tiranossauro... — disse Thorne.

        — Eu teria muito cuidado — avisou Malcolm.

        Thorne pôs a moto em ponto morto e desceu assim o resto da encosta. Quando chegou ao plano, desceu da moto. Sentia a terra vibrar sob os pés e nos arbustos à sua frente ouviu um rosnado profundo, como o ronronar de um enorme gato selvagem. Olhou em volta. Não viu nem sinal da bicicleta de Levine.

        Thorne tirou o rifle do ombro e o segurou com as mãos úmidas de suor. Ouviu o rosnado outra vez, aumentando e diminuindo. Então, percebeu alguma coisa estranha no som e depois de um curto momento compreendeu o que era.

        Vinha de mais de uma fonte, mais de um animal grande estava rosnando entre os arbustos bem à sua frente.

        Thorne apanhou um punhado de relva e jogou para o ar. A relva voltou e bateu nas suas pernas. Ele estava contra o vento. Entrou silenciosamente no meio da folhagem.

        As samambaias eram enormes e densas, mas adiante ele via o sol numa clareira. O rosnado estava muito alto agora. Havia outro som também — estranho, como um rangido. Era alto e a princípio, parecia quase mecânico, como uma roda com falta de óleo.

        Thorne hesitou. Então, muito lentamente, abaixou as folhas. E olhou, atônito.

       

       O NINHO

        À luz da manhã, dois tiranossauros enormes — seis metros de altura — surgiram ameaçadores na sua frente. A pele avermelhada parecia couro. As cabeças enormes ferozes, com mandíbulas imensas e dentes longos e aguçados. Mas por algum motivo Thorne não teve a sensação de estar ameaçado. Os animais moviam as cabeças lentamente, quase com delicadeza, por cima de uma barreira circular de lama de quase um metro e meio de altura. Com pedaços de carne vermelha na boca os dois adultos abaixaram a cabeça, atrás da parede de lama. O movimento foi recebido por um som alto e estridente que parou quase imediatamente. Então, os adultos ergueram as cabeças outra vez. Acarne tinha desaparecido.

        Não havia dúvida. Ali estava o ninho. E Malcolm estava certo. Um tiranossauro era bem maior do que o outro.

        Os guinchos estridentes recomeçaram. Pareciam de filhote de aves. Os adultos continuaram a abaixar e levantar a cabeça, alimentando os filhotes invisíveis. Havia um pedaço de carne no topo da muralha de terra. Thorne viu um filhote aparecer por cima da parede e começar a se arrastar para o lado. O filhote tinha o tamanho de um peru, com a cabeça e os olhos muito grandes. A penugem vermelha que cobria seu corpo fazia-o parecer frágil. Tinha um anel de penugem branca em volta do pescoço. O filhote guinchava repetidamente enquanto se arrastava desajeitado na direção da carne, usando os braços fracos. Mas, quando finalmente alcançou a carniça, avançou para a frente, mordendo a carne com os dentes pequenos e cortantes.

        Estava ocupado com o pedaço de carniça quando, de repente, deu um grito de susto e deslizou para fora do muro de terra. Imediatamente a mãe tiranossauro abaixou a cabeça e interceptou a queda do filhote, empurrando-o gentilmente de volta para o ninho. Thorne ficou impressionado com a delicadeza de movimentos, com o cuidado atencioso que ela dedicava ao filhote. O pai continuava a cortar pequenos pedaços de carne. Os dois animais ronronavam o tempo todo, como para tranqüilizar os filhotes.

        Thorne mudou de posição. Pisou num galho seco, que estalou com um ruído alto.

        Os dois adultos ergueram as cabeças imediatamente.

        Thorne ficou imóvel e prendeu a respiração.

        Os tiranossauros examinaram toda a área em volta do ninho, olhando atentamente em todas as direções. Seus corpos estavam tensos, as cabeças, alerta. Os olhos giravam de um lado para o outro, com pequenos movimentos bruscos da cabeça. Depois de um momento a tensão desapareceu. Balançaram a cabeça para cima e para baixo e esfregaram os focinhos um no outro. Parecia um movimento ritual, quase uma dança. Só então recomeçaram a alimentar os filhotes.

        Quando viu que eles estavam calmos, Thorne afastou-se silenciosamente na direção da moto. Arby murmurou no rádio.

        — Dr. Thorne, não estou vendo o senhor.

        Thorne não respondeu. Bateu com o dedo no microfone para indicar que tinha ouvido. Arby murmurou:

        — Acho que sei onde está o Dr. Levine. Está à sua esquerda. Thorne bateu outra vez no microfone, virou para a esquerda e

        viu uma bicicleta enferrujada na qual estava escrito "Prop. InGen Corporation". Estava encostada numa árvore.

        Nada mau, pensou Arby, olhando os vídeos remotos e clicando comandos. O monitor estava agora dividido em quatro partes. Permitia uma boa variedade de ângulos com imagens de bom tamanho.

        Numa delas ele via, de cima, os dois tiranossauros na clareira isolada. Metade da manhã já havia passado e o sol brilhava na relva amassada e cheia de lama da clareira. No centro, ele via o ninho dentro da muralha redonda de terra. Dentro havia quatro ovos brancos, do tamanho de uma bola de futebol americano. Havia também fragmentos de ovos e dois filhotes de tiranossauros que pareciam exatamente filhotes de passarinho, piando e sem penas. Estavam no ninho com as cabeças voltadas para cima, as bocas abertas, esperando o alimento. Kelly olhou para a tela e disse:

        —  Veja como são engraçadinhos. — E acrescentou. — Nós devíamos estar lá.

        Arby não respondeu. Não tinha muita certeza de querer estar mais perto dos animais. Os adultos estavam agindo com muita calma, mas para ele, a idéia de dinossauros era por demais perturbadora. Arby sempre encontrava segurança organizando e tendo sempre em ordem sua vida — até mesmo dispor as imagens corretamente na tela do computador era um calmante para ele. Mas tudo naquela ilha era desconhecido e imprevisível. Nunca sabia o que ia acontecer. Para Arby isso era muito perturbador.

        Quanto a Kelly, estava entusiasmada. Não parava da falar dos tiranossauros, do tamanho deles, do tamanho dos dentes. Parecia não sentir medo algum.

        Arby já estava irritado com ela.

        — Afinal — disse Kelly —, por que você pensa que sabe onde está o Dr. Levine?

        Arby apontou para a imagem do ninho, no monitor.

        —  VeJa.

        — Estou vendo.

        — Não. Fique olhando com atenção, Kel.

        A imagem se moveu um pouco, abrindo-se para a esquerda, depois centralizou outra vez.

        — Está vendo isso? — perguntou Arby.

        — E daí? Talvez o vento esteja balançando a câmera, ou coisa parecida.

        Arby balançou a cabeça.

        — Não, Kel. Ele está em cima da árvore. Levine está movendo a câmera.

        —  Oh! — Uma pausa. Ela olhou outra vez. — Talvez tenha razão.

        Arby pensou, com um largo sorriso, que não podia esperar mais de Kelly.

        — Sim, acho que tenho — ele disse.

        — Mas o que o Dr. Levine está fazendo lá?

        — Talvez ajustando a câmera. Ouviram a respiração de Thorne no rádio.

        Kelly olhou para as quatro imagens de vídeo, cada uma mostrando uma vista diferente da ilha e suspirou.

        — Mal posso esperar para ir até lá.

        — É, eu também — disse Arby. Mas não era verdade. Olhou    '] pela janela e viu o Explorer voltando com Eddie e Malcolm. Não disse nada, mas ficou contente com a volta deles.

       

        Thorne parou debaixo da árvore e olhou para cima. Não podia ver Levine, mas sabia que ele estava lá porque, na opinião de Thorne, ele estava fazendo um bocado de barulho. Thorne olhou nervosamente para a clareira atrás da folhagem densa. Ouvia ainda o ronronar dos filhotes, regular, ininterrupto.

        Thorne esperou. Que diabo Levine estava fazendo lá em cima, na árvore? Ouviu o farfalhar dos galhos e depois silêncio. Um resmungo. Os galhos farfalharam outra vez.                            

        E então Levine disse em voz alta.                                    

        — Oh, droga!

        O ruído de galhos se partindo e um grito de dor. Então Levine despencou bem na frente de Thorne, aterrissando de costas no chão. Rolou para o lado, segurando o ombro.

        — Diabo! — ele disse.

        Levine estava com a roupa caqui cheia de lama e rasgada cm vários lugares. Sob a barba de três dias, o rosto estava abatido « cheio de lama. Olhou para Thorne com um largo sorriso.

        — Ei, você é a última pessoa que eu esperava ver aqui. Mas chegou na hora exata.

        Thorne estendeu a mão, e Levine levantou o braço para segurá-la, quando, atrás deles, o tiranossauro rugiu ensurdecedoramente.

        — Oh, não! — exclamou Kelly.

        No monitor, os tiranossauros estavam agitados, movendo-se rapidamente em círculos, levantando as cabeças e urrando.

        — Dr. Thorne? O que está acontecendo? — perguntou Arby. Ouviram a voz de Levine, fraca e áspera no rádio, mas não compreendiam o que ele dizia. Eddie e Malcolm entraram no trailer. Malcolm olhou para o monitor e disse.

        — Diga a eles para saírem de lá agoral

        No monitor, os dois tiranossauros estavam de costas um para o outro, cada um olhando para um lado, em posição de defesa. Os filhotes estavam protegidos, no centro. Os adultos passavam as caudas de um lado para o outro no ninho, acima das cabeças dos filhotes. A tensão era palpável.

        Então um dos adultos urrou e avançou para fora da clareira.

        — Dr. Thorne! Dr. Levine! Saiam daí!

       

        Thorne montou na moto e segurou com força no guidom. Levine subiu na garupa, segurando na cintura dele. Thorne ouviu um rugido medonho e, ao olhar para trás, viu um dos tiranossauros explodir do meio da folhagem e avançar para eles. O animal estava correndo a toda a velocidade — cabeça abaixada, mandíbulas abertas, em posição de ataque.

        Thorne deu a partida, o motor elétrico zumbiu, a roda de trás girou na lama, sem se mover.

        — Vá! — gritou Levine. — Vá!

        O tiranossauro avançou para eles. Thorne sentiu o chão tremer. O rugido era tão alto que seus ouvidos doíam. O tiranossauro estava quase em cima deles, a cabeça enorme estirada para a frente, a boca aberta...

        Thorne firmou os calcanhares no chão, impelindo a moto para a frente. De repente, a roda traseira se soltou, jogando lama por todo o lado e a moto roncou velozmente na trilha. Thorne acelerou. A moto balançava e derrapava perigosamente na lama.

        Atrás dele, Levine gritava alguma coisa que Thorne não ouvia. Seu coração batia loucamente. A moto saltou numa vala e os dois quase perderam o equilíbrio, depois Thorne acelerou outra vez. Thorne não ousava olhar para trás. Sentia o cheiro de carne podre, ouvia a respiração áspera do animal gigantesco...

        — Vá com calma! — gritou Levine.                         

        Thorne o ignorou. A moto roncou subindo a colina. A folhagem batia neles, a lama saltava no rosto e no peito. Mais uma vez a moto saltou num buraco, deslizou para o lado, e ele a levou de volta para o meio da trilha. Ouviu outro rugido e teve a impressão de que estava mais fraco, mas...

         — Thorne! — gritou Levine, com a boca perto do ouvido dele.

        — O que está fazendo? Quer nos matar? Estamos sozinhos!

        Thorne chegou a um trecho plano da trilha e arriscou uma olhada para trás. Levine tinha razão. Estavam sozinhos. Não viu nem sinal do tiranossauro, mas ouvia ainda o rugido, agora distante.

        Ele diminuiu a marcha.

        — Calma — disse Levine, balançando a cabeça. Estava pálido de medo. — Você dirige pessimamente, sabia? Devia aprender. Quase nos matou.

        — Ele estava nos atacando — Thorne disse, zangado. Estava acostumado com o espírito crítico de Levine, mas naquele momento...

        —  Absurdo — disse Levine. — Ele não estava atacando ninguém.

        — Pois pode estar certo que parecia.

        —  Não, não, não — disse Levine. — Ele não estava nos atacando. O rex estava defendendo o ninho. Há uma grande diferença.

        — Não vi diferença nenhuma — insistiu Thorne. Parou a moto e olhou para Levine.

        — Para falar a verdade — explicou Levine —, se o rex tivesse resolvido nos atacar, estaríamos mortos agora. Mas ele parou quase imediatamente.

        — Parou? — perguntou Thorne.

        —  Certeza absoluta — respondeu Levine, com seu modo pedante. — O rex só queria nos assustar e defender seu território. Ele nunca deixaria o ninho indefeso, a não ser que tivéssemos tirado ou avariado alguma coisa. Tenho certeza de que neste momento ele está lá com a companheira, cuidando dos ovos, e não pretende ir a lugar nenhum.

        — Então, acho que é uma sorte ele ser um pai tão dedicado — disse Thorne, ligando o motor.           

        — E claro que é um pai dedicado — continuou Levine. — Qualquer tolo pode ver. Não notou como ele está magro? Está se alimentando mal para não faltar comida para os filhotes. Provavelmente faz isso há semanas. O tiranossauro rex é um animal complexo, com comportamento de caça complexo. E um comportamento complexo também no modo como cuida dos filhos. Eu não ficaria surpreso se verificasse que o papel de pai e mãe do tiranossauro rex dura alguns meses. Ele pode ensinar os filhotes a caçar, por exemplo. Começa trazendo pequenos animais feridos e deixa que os filhotes acabem com eles. Esse tipo de coisa. Seria interessante descobrir exatamente o que ele faz. Por que estamos parados aqui?

        Malcolm disse no rádio:

        — Jamais ocorreria a ele agradecer a você por salvar sua vida. Thorne rosnou:

        — E evidente que não.

        —  Com quem está falando? — perguntou Levine. — Com Malcolm? Ele está aqui?

        — Está — disse Thorne.

        — Ele está concordando comigo, não está?

        — Não exatamente — disse Thorne, balançando a cabeça.

        — Escute, Thorne — disse Levine. — Sinto muito se ficou aborrecido. Mas não tem motivo nenhum. A verdade é que nem por um momento corremos perigo, exceto com seu modo de dirigir a moto.

        — Ótimo. Isso é ótimo. — O coração de Thorne saltava como louco no peito. Ele respirou fundo, virou a moto para a esquerda e seguiu a trilha, de volta para os trailers.

        Atrás dele, Levine disse:   

         — Estou muito feliz por vê-lo, Thorne. De verdade.

        Thorne não respondeu. Continuou a descer na trilha, entre a folhagem. Chegando ao vale, ele acelerou. Logo viram os trailers na clareira, lá embaixo. Levine disse:

        — Ótimo. Você trouxe tudo. O equipamento está funcionando? Tudo em boas condições?

        — Tudo parece ótimo.

        — Perfeito — disse Levine. — Então isto é simplesmente perfeito.

        — Talvez não — disse Thorne.

        Dentro no trailer, Arby e Kelly acenavam alegremente atrás do vidro da janela.

        — Está brincando — disse Levine.

       

      QUARTA   CONFIGURAÇÃO

       

        Aproximando-se do limite caótico, os elementos demonstram conflito interno. Uma região instável e potencialmente letal.

        IAN MALCOLM

       

       LEVINE

        Eles atravessaram a clareira correndo e gritando:       

        — Dr. Levine! Dr. Levine! Está salvo! — Abraçaram.Leyjne e ele olhou para Thorne.                                               

        — Isto foi muito insensato — disse Levine.

        — Por que não explica isso a eles? — perguntou Thorne. — Eles são seus alunos.

        —  Não fique zangado, Dr. Levine — Kelly pediu. — Nós viemos por nossa conta.

        — Por sua conta?

        —  Pensamos que o senhor precisasse de ajuda — disse Arby.

        — E precisava. — Olhou para Thorne.

        — Sim. Eles nos ajudaram — confirmou Thorne.

        — E prometemos que não vamos atrapalhar — disse Kelly. — Façam o que têm de fazer, que nós...

        — Os meninos estavam preocupados com você — disse Malcolm.

        — Julgaram que estivesse em apuros.

        —  Afinal, por que toda a pressa? — quis saber Thorne. — Mandou construir todos esses veículos e depois veio embora sem nenhum deles...

        — Não tive escolha — disse Levine. — O governo está às voltas com uma epidemia de um novo tipo de encefalite. Acham que está relacionada com as ocasionais carcaças de dinossauros que aparecem por lá, levadas pelo mar. E claro que a idéia é idiota, mas isso não impede que continuem a destruir os animais, assim que os encontram. Tive de ir lá primeiro. O tempo é curto.

        — Depois, veio para cá sozinho — disse Malcolm.

        — Bobagem, Ian. Deixe de fazer essa cara. Eu ia telefonar para você, assim que tivesse verificado o que havia nesta ilha. E não vim sozinho. Vim com um guia chamado Diego, que jurou ter estado nesta ilha alguns anos atrás, quando menino. E parecia ter bastante experiência. Levou-me ao alto do rochedo sem problema. E tudo estava indo muito bem até sermos atacados no regato e Diego...

        — Atacados? — perguntou Malcolm. — Pelo quê?

        — Na verdade, eu não vi — disse Levine. — Tudo aconteceu muito depressa. O animal me derrubou, rasgou minha mochila e na verdade não sei o que aconteceu depois disso. É possível que o formato da mochila o tenha confundido, porque eu levantei e corri e ele não me perseguiu.

        Malcolm olhava atônito para ele.

        — Você teve muita sorte, Richard.                               

        — Sim. Bem, eu corri por um longo tempo. Quando olhei para trás, estava sozinho na selva. E perdido. Não sabia o que fazer e subi numa árvore. Pareceu-me uma boa idéia e depois, mais ou menos no começo da noite, os velocirraptores apareceram.

        — Velocirraptores? — perguntou Arby.

        — Pequenos carnívoros — disse Levine. — O formato do corpo é basicamente de um terópodo, focinho comprido, visão binocular. Um dinossauro pequeno, muito rápido, muito inteligente e muito perigoso; e eles andam em grupos. E ontem à noite havia oito deles, saltando em volta da árvore, tentando me pegar. Durante a noite inteira, pulando, pulando e rosnando... Não consegui dormir um minuto.

        — Ora, que pena — disse Eddie.

        — Escute — Levine disse, irritado. — Não é meu problema se...

        — Você passou a noite na árvore? — quis saber Malcolm.

        — Passei. E de manhã os raptores tinham ido embora. Então desci e comecei a andar. Encontrei o laboratório ou seja lá o que for. E evidente que foi abandonado às pressas, deixando alguns animais para trás. Andei pelo prédio todo e descobri que ainda há eletricidade — alguns sistemas ainda funcionam, depois de todos esses anos. E o mais importante: há uma rede de câmeras de segurança. Uma grande sorte. Então resolvi ver como estavam as câmeras, e estava trabalhando quando vocês interromperam...

       

        — Espere um pouco — disse Eddie. — Viemos aqui para salvá-lo.

        — Não sei por quê — disse Levine. — Estou certo de que nunca pedi que fizessem isso.

        — Parecia que queria — disse Thorne — no telefone.

        — Aquilo foi um mal-entendido — explicou Levine. — Fiquei preocupado por um momento porque não conseguia fazer o telefone funcionar. Thorne, você fez esse telefone muito complicado. Esse é o problema. Então, podemos começar?

        Olhou para os rostos zangados a sua volta. Malcolm disse para Thorne:

        — Um grande cientista e um grande ser humano.

        — Ouçam — disse Levine. — Eu não sei qual é o problema de vocês. A expedição viria a esta ilha mais cedo ou mais tarde. Dadas as circunstâncias, quanto mais cedo, melhor. Tudo saiu muito bem e, francamente, não vejo motivo para discussão. Não é a hora para briguinhas tolas. Temos coisas importantes para fazer, e acho que devemos começar. Porque esta ilha é uma oportunidade extraordinária e não vai durar para sempre.

       

       DODGSON

        Lewis Dodgson estava de frente para o balcão do bar, num canto escuro da Chesperito Cantina, em Puerto Cortês, tomando uma cerveja. Ao lado dele, George Baselton, o catedrático de biologia de Stanford, devorava avidamente um prato de huevos rancheros. As gemas se derramavam sobre a salsa verde. Dodgson sentia náuseas só de olhar. Virou o rosto, mas ouvia ainda Baselton lambendo os lábios ruidosamente.

        O bar estava vazio, a não ser pelas galinhas ciscando no chão. Uma vez ou outra um garoto chegava na porta, atirava pedras nas galinhas e corria para fora, rindo satisfeito. O estéreo arranhava uma antiga canção de Elvis Presley na caixa acústica enferrujada acima do bar. Dodgson cantarolava "Falling in Love with You", tentando conter a irritação. Estava sentado naquele monte de lixo há quase uma maldita hora.

        Baselton terminou os ovos e empurrou o prato. Tirou então do bolso o pequeno bloco de anotações que tinha sempre à mão.

        —  Muito bem, Lewis — ele disse. — Estive pensando no melhor meio de resolver isso.

        — Resolver o quê? — perguntou Dodgson, de mau humor. — Não há nada para resolver, desde que possamos chegar àquela ilha. — Enquanto falava, pôs uma pequena foto de Richard Levine na ponta do balcão do bar. Examinou as costas da foto, virou-a de cabeça para baixo. Depois de cabeça para cima.

        Suspirou e olhou para o relógio.

        — Lewis — Baselton disse, impaciente —, chegar à ilha não é a parte importante. O importante é como vamos apresentar ao mundo a nossa descoberta.

        Dodgson pensou por um momento e depois disse:

        —  Nossa descoberta. Gostei disso, George. É muito bom mesmo. Nossa descoberta.

        —  Bem, é a verdade, não é? — disse Baselton com um leve sorriso. — A InGen está falida, sua tecnologia perdida para a humanidade. Uma perda trágica, muito trágica, como eu disse muitas vezes na televisão. Mas, dadas as circunstâncias, qualquer um que volte a encontrá-la faz uma descoberta. Não sei de que outro modo se pode chamar. Como disse Henri Poincaré...

        —  Tudo bem — disse Dodgson. — Então, fazemos uma descoberta. E depois? Damos uma entrevista coletiva?

        —  Definitivamente, não. — Baselton ficou horrorizado. — Uma coletiva seria algo por demais grosseiro. Ficaríamos expostos a todo tipo de crítica. Não, não. Uma descoberta dessa magnitude deve ser tratada com decoro. Deve ser comunicada, Lewis.

        — Comunicada?

        —  Por meio da literatura especializada. A Nature, eu creio. Sim.

        Dodgson entrecerrou os olhos.

        — Você quer anunciar numa publicação acadêmica?

        —  Sabe de um meio melhor para torná-la legítima? — disse Baselton. — É perfeitamente apropriado apresentar nossas descobertas aos nossos pares acadêmicos. É claro que vai provocar um debate — mas no que consistirá esse debate? Uma discussão acadêmica, professores discordando de professores, que vai ocupar as seções de ciência dos jornais durante três dias, até ser substituída pelas últimas novidades sobre implante de mamas. E nesses três dias já estabelecemos o nosso direito de posse.

        — Você vai redigi-lo?

        — Vou — disse Baselton. — E mais tarde, acho, um artigo na American Scholar, ou talvez na Natural History. Alguma coisa com interesse humano, o que significa essa descoberta para o futuro, o que nos conta sobre o passado, toda essa...

        Dodgson assentiu com um gesto. Reconhecia que Baselton estava certo, lembrou o quanto precisava dele e como foi inteligente chamá-lo para fazer parte da equipe. Dodgson jamais pensava na reação do público. E Baselton não pensava em outra coisa.

       

        — Bem, isso é ótimo — ele disse. — Mas nada tem importância se não chegarmos àquela ilha. — Consultou o relógio outra vez.

        Uma porta se abriu atrás deles e o assistente de Dodgson, Howard King, entrou, rebocando um costa-riquenho forte e atarracado, de bigode. O homem tinha o rosto marcado pelas intempéries e uma expressão carrancuda.

        Dodgson virou o corpo na banqueta.

        — Este é o homem?

        — Sim, Lew.

        — Qual o nome dele?

        — Gandoca.

        — Senor Gandoca. — Dodgson mostrou a foto de Levine. — Conhece este homem?

        Gandoca mal olhou para a foto e fez que sim com a cabeça.

        — Si. Senor Levine.

        — Certo. Senor cretino Levine. Quando ele esteve aqui?

        — Há poucos dias. Ele saiu com Dieguito, meu primo. Ainda não voltaram.

        — E aonde eles foram?

        — Islã Sorna.

        —  Ótimo — disse Dodgson, acabando de tomar a cerveja e empurrando a garrafa. — Você tem barco? — Virou para King. — Ele tem um barco?

        — Ele é pescador — disse King. — Tem um barco. Gandoca fez que sim e disse:

        — Um barco de pesca. Si.

         — Ótimo. Eu também quero ir à Islã Sorna.

        — Si, senor, mas hoje o tempo...

        — Pouco me importa o tempo — disse Dodgson. — O tempo vai melhorar. Quero ir agora.

        — Talvez mais tarde...

        — Agora.

          Gandoca levantou as mãos abertas.

        — Eu sinto muito, senor...

        Dodgson disse:                                               

        — Mostre o dinheiro para ele, Howard.

        King abriu uma valise cheia de notas de cinco mil colóns. Gandoca olhou, apanhou uma das notas, examinou. Pôs na valise cuidadosamente, balançou o corpo.

        — Eu quero ir agora — disse Dodgson.

        — Si, senor — respondeu Gandoca. — Partimos quando o senor estiver pronto.

        — Assim é melhor — disse Dodgson. — Quanto tempo leva para chegar à ilha?

        — Umas duas horas, senor.

         — Muito bem. Isso é ótimo.

       

       O POSTO DE OBSERVAÇÃO

        — Aqui vamos nós!

        Ouviram um clique quando Levine ligou o cabo flexível do guincho elétrico do Explorer e apertou o botão. O cabo girou lentamente à luz do sol.

        Estavam agora numa extensa planície coberta de relva na base do rochedo. O sol do meio-dia estava alto no céu, refletindo na borda rochosa da ilha. Lá embaixo, o vale cintilava com as ondas de calor.

        Uma manada de hipsilofodontes pastava a uma pequena distância. Os animais verdes, parecidos com gazelas, erguiam a cabeça ocasionalmente acima da relva e olhavam para eles sempre que ouviam o ruído de metal, enquanto Eddie e os meninos armavam o suporte de alumínio, motivo de tanta especulação quando estavam na Califórnia. O conjunto parecia agora um monte de longarinas estreitas — uma versão aumentada de escoras de picape — sobre a relva.

        — Agora vamos ver — disse Levine, esfregando as mãos. Quando o motor foi ligado, as longarinas começaram a se

        mover e lentamente ergueram-se no ar. A estrutura parecia frágil e delicada, mas Thorne sabia que os suportes cruzados garantiam uma grande resistência. Desdobrando as longarinas, a estrutura ergueu-se a três metros de altura, depois a quatro metros e meio e finalmente parou. A pequena casa no alto estava logo abaixo dos galhos mais baixos das árvores próximas, que quase a escondiam de vista. Mas a armação, como um andaime, brilhava ao sol.

        — É isso? — perguntou Arby.

        — Sim, é isso. — Thorne andou em volta, encaixando os pinos para manter a estrutura de pé.

        —  Mas brilha demais — disse Levine. — Devíamos ter feito escura.

        —  Eddie, precisamos esconder isto — disse Thorne.

        —  Quer usar spray? Acho que eu trouxe tinta preta. Levine balançou a cabeça.

        — Não, a tinta tem cheiro forte. Que tal aquelas palmeiras?

        —  Certo. Podemos fazer isso. — Eddie foi até as palmeiras e começou a cortar as folhas com sua pequena machadinha.

        Kelly olhou para a construção de alumínio.

        — E legal — ela disse. — Mas o que é?

        —  Um esconderijo aéreo — disse Levine. — Venha. — Ele começou a escalar o andaime.

        A estrutura no topo era uma pequena casa, o teto escorado por barras de alumínio a intervalos de um metro e vinte umas das outras. O assoalho era também de barras de alumínio, porém mais juntas, com intervalos de mais ou menos quinze centímetros. Era escorregadio, e Levine apanhou algumas folhas de palmeira que Eddie estava suspendendo com uma corda e cobriu o chão com elas. As outras folhas de palmeira ele prendeu no lado de fora da casa, escondendo a estrutura.

        ' Arby e Kelly olharam para os animais. Do alto viam todo o vale. Viram um bando mais distante de apatossauros, no outro lado do rio. Um grupo de tricerátops pastava ao norte. Perto da água, alguns dinossauros bicos-de-pato com cristas longas aproximaram-se para beber. Um grito surdo dos bicos-de-pato flutuou pelo vale na direção deles, um som profundo e não deste mundo. Logo depois, ouviram a resposta vinda da floresta no outro lado do vale.

        — O que foi isso? — Kelly perguntou.

        — Um parassauro — disse Levine. — Ele solta o grito através da crista na nuca. Sons de baixa freqüência atingem grandes distâncias.

        Ao sul viram um bando de animais verde-escuros com a parte da frente da cabeça grande e saltada e uma fileira de chifres pequenos e nodosos. Pareciam búfalos.   

        — Como se chamam aqueles? — Kelly perguntou.

        —  Boa pergunta — disse Levine. — Provavelmente são Pa-chycephalosaurus wyomingensis. Mas é difícil dizer com certeza porque nunca foi encontrado um esqueleto completo desses animais. A testa é de osso muito espesso, por isso temos encontrado vários fragmentos da parte superior do crânio. Mas esta é a primeira vez que eu vejo o animal inteiro.

        — E aquelas cabeças? Para que servem? — quis saber Arby.

        — Ninguém sabe — disse Levine. — Todos supõem que sejam usadas para dar marradas, para as lutas dos machos de diversas espécies. A competição para ganhar as fêmeas, coisas assim.

        Malcolm já estava lá em cima também.

        — Sim, para dar marradas — ele disse, sombriamente. — Como vocês estão vendo agora.

        — Tudo bem — disse Levine — então, eles não estão dando marradas no momento. Talvez a época da procriação já tenha terminado.

        — Ou talvez eles nunca façam isso — disse Malcolm, olhando para os animais verdes. — Eles me parecem muito pacíficos.

        — Sim — disse Levine —, mas é claro que isso não quer dizer nada. O búfalo africano parece manso a maior parte do tempo, também, quase sempre fica um tempo enorme imóvel. Contudo, são animais imprevisíveis e muito perigosos. Temos de supor que aquelas cabeças existem por alguma razão, mesmo que não estejamos vendo agora.

        Levine voltou-se para os meninos.

        — Por isso eu fiz esta estrutura. Queremos observar os animais vinte e quatro horas por dia. Até onde for possível, queremos registrar suas atividades.

        — Por quê? — perguntou Arby.

        — Porque — foi Malcolm quem respondeu — esta ilha apresenta uma oportunidade única de estudar o maior mistério da história do nosso planeta: a extinção.

        — Vejam só — disse Malcolm —, quando a InGen fechou definitivamente suas instalações, agiram apressadamente e deixaram alguns animais vivos. Isso foi há cinco ou seis anos. Os dinossauros crescem depressa, a maioria das espécies atinge a maturidade em quatro ou cinco anos. A esta altura, a primeira geração dos dinossauros da InGen — concebidos em laboratório — já está adulta e começou a criar uma nova geração inteiramente selvagem. Agora existe um sistema ecológico completo nesta ilha, com dezenas de espécies de dinossauros vivendo em pequenos grupos sociais, pela primeira vez, em sessenta e cinco milhões de anos.

        — E por que isso é uma oportunidade? — perguntou Arby. Malcolm apontou para a planície.

        — Bem, pense um pouco. A extinção é um tema de pesquisa muito difícil. Existem dezenas de teorias conflitantes. Galileu podia subir na Torre de Pisa e jogar bolas para testar sua teoria. Na verdade, ele nunca fez isso, mas podia ter feito. Newton usou prismas para testar sua teoria ótica. Os astrônomos observaram eclipses para testar a teoria da relatividade, de Einstein. Os testes são feitos em todos os ramos da ciência. Mas como conduzir testes de uma teoria da extinção? Não é possível.

        — Mas aqui... — disse Arby.

        —  Sim — continuou Malcolm —, o que temos aqui é uma população de animais extintos artificialmente introduzidos num ambiente fechado, podendo voltar a evoluir. Nunca houve nada parecido em toda a história. Já sabemos que esses animais foram extintos uma vez. Mas ninguém sabe por quê.

        — E vocês esperam descobrir? Em alguns dias?

        — Sim — disse Malcolm. — Esperamos.

        —  Como? Não acham que eles vão ser extintos outra vez, acham?

        — Quer dizer, na frente dos nossos olhos? — Malcolm riu. — Não, não. Nada disso. Mas o caso é que pela primeira vez não estamos estudando apenas ossos. Estamos vendo os animais e observando seu comportamento. Eu tenho uma teoria e acho que, mesmo num curto espaço de tempo, veremos sua comprovação.

        —  Que provas? — perguntou Kelly.

        — Que teoria? — disse Arby. Malcolm sorriu.

        — Aguardem — ele disse.

       

       A RAINHA DE COPAS

        Os apatossauros desceram até o rio no calor do dia. Seus pescoços curvos e graciosos refletiam-se na água quando se inclinavam para beber. As caudas finas como chicotes balançavam preguiçosamente. Sete apatossauros mais jovens e menores que os adultos brincavam no meio do bando.

        — Belíssimo, não é? — disse Levine. — O modo como tudo se encaixa. Simplesmente lindo. — Virou para o lado e gritou para Thorne: — Onde está minha armação?

        — Subindo — disse Thorne.

        A corda ergueu um pesado tripé com base larga e uma moldura circular na parte de cima. Sobre ela estavam cinco câmeras de vídeo com fios ligados aos painéis solares. Levine e Malcolm começaram a armar as câmeras.

        — O que acontece com o vídeo? — perguntou Arby.

        — Os dados são multiplexados e nós os enviamos direto para a Califórnia. Via satélite. Será ligado tambemna rede de segurança da ilha. Assim teremos vários pontos de observação ao mesmo tempo.

        — E não precisamos estar aqui?

        — Certo.                                                                            

        — E é isso que vocês chamam de esconderijo?

        — Sim. Pelo menos é assim que cientistas como Sarah Harding chamam.

        Thorne subiu também. Era muita gente para o pequeno abrigo, mas Levine aparentemente não notou. Com um binóculo, observava atentamente os dinossauros na planície. 

        — Exatamente como pensamos — ele disse para Malcolm. — Organização espacial. Filhotes e os mais novos no centro do bando, adultos protetores na periferia. Os apatossauros usam a cauda como defesa.

        — Pelo menos parece.

        — Oh, não há dúvida quanto a isso. — Levine suspirou. — Etão bom provar que estamos certos.

        Lá embaixo, Eddie desempacotou a gaiola circular de alumínio, a mesma que tinham visto na Califórnia. Tinha cerca de um metro e oitenta de altura e um metro e vinte de diâmetro, construída com barras de titânio de dois centímetros de espessura.          

        —  O que quer que eu faça com isto? — ele perguntou.

        — Deixe aí embaixo — disse Levine. — E o lugar dela.      

          Eddie armou a gaiola no canto do andaime. Levine desceu.

        — E isso, para que serve? — perguntou Arby. — Vai pegar um dinossauro?

        —  Na verdade, justamente o contrário. — Levine prendeu a gaiola ao lado do andaime. Abriu e fechou a porta para ver se estava em ordem. Verificou a fechadura, deixando a chave com a tira de elástico pendurada. — É uma gaiola para predadores, como as gaiolas para tubarões — ele disse. — Se você estiver andando aqui embaixo e acontecer alguma coisa, entra aqui e está a salvo.

        — Se acontecer o quê? — perguntou Arby, preocupado.

        — Na verdade, não acredito que aconteça alguma coisa — disse Levine, subindo outra vez. — Porque duvido que os animais dêem atenção a nós ou a esta pequena casa, depois que estiver bem camuflada.

        — Quer dizer que não vão ver a casa?                              

        —  Oh, eles vão ver, mas vão ignorar.              

        — Mas, se nos farejarem... Levine balançou a cabeça.

        — A casa está num lugar em que o vento que prevalece na ilha está na nossa direção. E deve ter notado que essas samambaias têm um cheiro característico. — Era um cheiro levemente picante, quase como de eucalipto.

        Arby continuava preocupado.                                            

        — Mas e se eles comerem as samambaias?   

       

        —  Não comem — disse Levine. — Essas samambaias são Dicranopterus cyatheoides, levemente tóxicas, e provocam uma erupção no interior da boca. Há uma teoria de que sua toxidez se desenvolveu durante o Jurássico, como defesa contra os dinossauros vegetarianos.

        — Não é uma teoria — disse Malcolm. — Apenas suposição sem fundamento.

        — Mas há alguma lógica nisso — observou Levine. — A vida das plantas no Mesozóico deve ter sido extremamente ameaçada pelo aparecimento dos grandes dinossauros. Manadas de herbívoros gigantes, cada animal consumindo centenas de quilos de matéria vegetal por dia, certamente dariam para exterminar as plantas que não tivessem criado alguma defesa — um gosto desagradável, espinhos, cerdas ou toxidez química. Assim, talvez as cyatheoides tenham desenvolvido essa toxidez naquela época. E bastante eficiente porque os animais de hoje também não comem essa planta, em nenhum lugar do mundo. Por isso são tão abundantes, como devem ter notado.

        — As plantas têm defesas? — perguntou Kelly.

        — E claro que têm. As plantas evoluem como qualquer forma de vida e criam os próprios modos de agressão, defesa e assim por diante. No século XIX, a maior parte das teorias era sobre animais — natureza vermelha, com dentes e garras e tudo o mais. Porém hoje os cientistas estão pensando na natureza verde, com raízes e hastes. Compreendemos que as plantas, na sua luta constante para sobreviver, desenvolveram tudo, desde uma simbiose complexa com outros animais até mecanismos de sinalização para avisar as outras plantas, para se defender da guerra química.

        Kelly perguntou, intrigada:

        — Sinalização? De que tipo?

        — Ah, temos vários exemplos — disse Levine. — Na África, as árvores de acácia criaram espinhos longos e afiados — com sete centímetros mais ou menos —, mas isso só serviu para fazer com que certos animais, como as girafas e os antílopes, desenvolvessem línguas mais longas que alcançavam além dos espinhos. Só os espinhos não adiantavam. Então, na corrida evolutiva, as árvores de acácia criaram uma nova defesa, a toxidez. Começaram a produzir grandes quantidades de tanino em suas folhas, o que provoca uma reação metabólica letal nos animais. Literalmente os mata. Ao mesmo tempo, as acácias desenvolveram uma espécie de sistema químico de alarme. Se o antílope começa a comer as folhas de uma árvore, essa árvore libera etileno no ar e as árvores próximas aumentam a produção do tanino nas folhas. Dentro de cinco ou dez minutos, todas as outras árvores estão produzindo mais tanino, tornando-se assim venenosas.

        — E o que acontece com o antílope? Ele morre?

        —  Bem, não. Não morre mais porque a corrida evolutiva continuou. Os antílopes acabaram aprendendo que só podiam comer as folhas por pouco tempo. Assim que as árvores começavam a produzir mais tanino, tinham de parar de comer. E esses herbívoros desenvolveram novas estratégias. Por exemplo, quando uma girafa come as folhas de uma árvore de acácia, ela evita todas as árvores que estejam a favor do vento e procura uma árvore mais distante. Assim, os animais se adaptaram a essa defesa também.

        — Na teoria da evolução isso se chama fenômeno da Rainha de Copas — disse Malcolm. — Porque, em Alice no país das maravilhas, a Rainha de Copas diz para Alice que ela tem de correr o mais depressa possível para ficar onde está. E assim que parece ser a espiral evolutiva. Todos os organismos evoluem numa fúria louca só para conservar o mesmo equilíbrio. Para ficar onde estão.

        —  E isso é comum? Mesmo entre as plantas? — perguntou Arby.

        —  Sim, é — disse Levine. — A seu modo, as plantas são extremamente ativas. Os carvalhos, por exemplo, produzem tanino e fenol para se defender das lagartas. Um bosque inteiro é alertado assim que uma árvore é infestada. É um modo de proteger todo o bosque, uma espécie de cooperação entre as árvores, podemos dizer.

        Arby balançou a cabeça afirmativamente e olhou lá do alto para os apatossauros, ainda na margem do rio.

        —  Então — ele disse — é por isso que os dinossauros não comeram todas as árvores da ilha? Porque esses grandes apatossauros devem comer muitas plantas. Têm pescoço comprido para alcançar os galhos mais altos. Mas as árvores estão praticamente intactas.

        — Muito bem — disse Levine. — Eu também notei isso.

        — E por causa das defesas das plantas?

        — Bem, pode ser — disse Levine. — Mas eu acho que há umâ explicação muito simples para a preservação das árvores.

        — O que é?

        — Basta olhar — disse Levine. — Está na frente dos seus olhos.

       

        Arby apanhou um binóculo e observou as manadas.

        —  Qual é a explicação simples?

        —  Entre os paleontólogos — disse Levine — há um debate interminável sobre por que os apatossauros têm pescoço comprido. Esses animais que está vendo têm seis metros de pescoço. A crença tradicional é que eles desenvolveram esse pescoço comprido para comera folhagem mais alta, que não pode ser alcançada por outros animais.

        —  Então? Por que a discussão? — perguntou Arby.

        — A maioria dos animais neste planeta tem pescoço curto — disse Levine — porque um pescoço comprido é, bem, é uma chateação. Provoca uma série de problemas. Problemas estruturais: a disposição dos músculos e ligamentos para dar suporte a um pescoço longo. Problemas comportamentais: os impulsos nervosos precisam percorrer uma longa distância do cérebro ao corpo. Problemas de deglutição: o alimento percorre uma grande distância da boca até o estômago. Problemas respiratórios: o ar tem de ser aspirado através de um canal muito longo. Problemas cardíacos: o sangue tem de ser bombeado até a cabeça, do contrário o animal desmaia. Em termos de evolução, tudo isso é difícil.

        — Mas as girafas fazem — observou Arby.

        — Sim, elas fazem. Mas os pescoços das girafas não têm nem metade desse comprimento. As girafas têm coração muito grande e uma fáscia espessa em volta do pescoço. Na verdade, o pescoço da girafa é como uma bainha de pressão sangüínea que vai até em cima.                                                                                  

        —  Os dinossauros têm essa bainha?

        — Não sabemos. Supomos que os apatossauros tenham coração enorme, talvez com cento e cinqüenta quilos ou mais. Porém, há outra solução possível para o problema de bombear o sangue num pescoço muito longo.

        — Qual é?

        — Você está olhando para ela neste momento. Arby bateu palmas.

        — Eles não levantam o pescoço!

        — Correto — disse Levine. — Pelo menos não com freqüência nem por longo tempo. E claro que, neste momento, os animais estão bebendo, portanto os pescoços estão abaixados, mas meu palpite é que, se os observarmos por algumas horas, vamos descobrir que não ficam muito tempo com o pescoço levantado.

        — Por isso não podem comer as folhas das árvores!

        —  Certo.

        — Mas se o pescoço comprido não é usado para comer, então para que serve? — perguntou Kelly.

        Levine sorriu.

        — Deve ter uma utilidade e acho que é para defesa.

        — Defesa? Pescoço comprido? — Arby perguntou intrigado. — Não compreendo.

        — Continue olhando — disse Levine. — Na verdade é mais do que óbvio.

        Arby olhou com o binóculo e disse para Kelly:    

         — Detesto quando ele diz que é óbvio.                    

        — Eu sei — ela disse suspirando.                                 

        Arby olhou para Thorne. Thorne ergueu dois dedos em V e depois dobrou um deles. O movimento fez com que o outro dedo se movesse também. Portanto, os dois eram ligados... Se era uma pista, Arby não entendeu. Franziu a testa. Thorne disse só com o movimento dos lábios: "Ponte." Arby olhou e viu as caudas que pareciam chicotes balançando acima dos animais mais jovens.

        — Já sei! — exclamou. — Eles usam a cauda para defesa. E precisam de pescoço comprido para contrabalançar a cauda longa. É como uma ponte pênsil!

        Levine olhou atentamente para ele.           

        — Descobriu muito depressa. Thorne ficou de costas, escondendo um sorriso.

        — Mas estou certo... — disse Arby.

        — Sim, está absolutamente certo. Os pescoços longos existem porque as caudas longas existem. Nos terópodos, que andam nas patas traseiras, a situação é outra. Mas nos quadrúpedes tem de haver um contrapeso para a cauda longa, do contrário o animal cai para a frente.

        —  Na realidade, há uma coisa muito mais interessante nesse bando de apatossauros — acrescentou Malcolm.

        — Sim? O que é? — perguntou Levine.

        — Eles não são adultos verdadeiros — explicou Malcolm. — Os animais que estamos vendo são muito grandes pelos nossos padrões. Mas na verdade nenhum deles atingiu ainda o tamanho de adulto. Acho isso muito estranho.

        — Acha? Pois para mim não é nada estranho — disse Levine. — Sem dúvida, isso se dá simplesmente porque não tiveram tempo suficiente para chegar à maturidade. Tenho certeza de que os apatossauros crescem mais devagar do que os outros dinossauros. Afinal, os grandes mamíferos, como os elefantes, crescem mais devagar do que os mamíferos menores.

        Malcolm balançou a cabeça.

        — A explicação não é essa.

        — Não? Então qual é?

        —  Continue olhando — Malcolm disse, apontando para a planície. — Na verdade é extremamente óbvio.

        Os meninos riram.

        Levine estremeceu, demonstrando seu desagrado.

        —  O que me parece óbvio — ele disse — é que nenhuma das espécies parece ter chegado ao amadurecimento completo. Os tricerátops, os apatossauros e até mesmo os parassauros são um pouco menores que o que podíamos esperar. Isso sugere um fator consistente, algum elemento da dieta, os efeitos do confinamento numa pequena ilha, talvez até mesmo o modo como foram criados. Mas não considero isso especialmente notável ou motivo para preocupação.

        — Talvez tenha razão — disse Malcolm. — Talvez não tenha.

       

       PUERTO CORTÊS

        — Não há nenhum vôo? — perguntou Sarah Harding. — Como não há nenhum vôo?

        Eram onze horas da manhã. Harding tinha voado quinze horas, grande parte desse tempo no avião militar norte-americano que tomara de Nairóbi para Dallas. Estava exausta. Sentia a pele pegajosa, precisava de um chuveiro e queria trocar de roupa. Mas estava ali discutindo com aquele funcionário teimoso, numa cida-dezinha insignificante no oeste de Costa Rica. A chuva tinha parado, mas o céu continuava cinzento, com nuvens baixas sobre o aeroporto deserto.

        — Sinto muito — disse Rodríguez. — Não podemos providenciar nenhum vôo.

        —  Mas e o helicóptero que levou aqueles homens há pouco tempo?

        — Sim, temos o helicóptero.

        — Onde ele está?                                                         

        — O helicóptero não está aqui.                                      

        — Estou vendo, mas onde está? Rodríguez abriu as duas mãos,

        — Foi para San Cristóbal.

        — Quando vai voltar?

        — Eu não sei. Acho que amanhã ou talvez depois de amanhã.

        — Senor Rodríguez — ela disse com firmeza. — Preciso estar naquela ilha hoje.

        — Compreendo o que a senhora quer — disse Rodríguez. — Mas não posso fazer nada.

        — O que o senhor sugere?                                                  Rodríguez deu de ombros.

        — Eu não poderia dar nenhuma sugestão.

        — Não tem um barco que possa me levar?

        — Não sei de nenhum barco.                                    

        — Isto é um porto. — Ela apontou para as ilhas. — Estou vendo uma porção de barcos.

        — Eu sei. Mas não acredito que algum vá até as ilhas. O tempo não está muito favorável.

        — Mas e se eu fosse até lá...

        — É claro. — Rodríguez suspirou. — É claro que pode perguntar. Assim, um pouco depois das onze horas de uma manhã chuvosa, Sarah Harding estava caminhando na doca precária de madeira, com a mochila nas costas. Quatro barcos estavam ancorados na doca, que cheirava a peixe, mas todos pareciam vazios. A atividade parecia se limitar à outra extremidade do porto, onde um barco bem maior estava ancorado. Ao lado do barco, um jipe Vanguard vermelho estava sendo preparado para embarcar, além de vários grandes tambores de aço e engradados de madeira com suprimentos. Sarah observou o carro, evidentemente adaptado, do tamanho de um Land Rover Defender, o melhor de todos os veículos para pesquisa de campo. A adaptação do jipe devia ter sido bastante dispendiosa, pensou ela. Só acessível a pesquisadores com muito dinheiro.

        Dois americanos com chapéus de abas largas gritavam e apontavam para o jipe, que foi erguido meio de lado por um guindaste muito antigo e levado para o convés do barco. Um dos homens gritou: "Cuidado! Cuidado!", quando o jipe pousou com um baque surdo no convés de madeira. "Que droga, tenham cuidado!" Vários carregadores começaram a levar as caixas para o barco. O guindaste voltou para apanhar os tambores de aço.

        Harding se aproximou de um dos homens e perguntou delicadamente:

        —  Com licença, será que pode me ajudar?

        O homem olhou rapidamente para ela. Era de altura mediana, pele avermelhada e traços simpáticos. Parecia tenso, preocupado e pouco à vontade com a roupa nova de safári.

        —  Estou ocupado agora — ele disse, dando as costas para Sarah. — Manuel! Tenha cuidado, esse equipamento é delicado!

        — Desculpe se o incomodo, mas meu nome é Sarah Harding e estou tentando... — ela insistiu.

        — Pode ser até Sarah Bernhardt... Manuel! Mas que droga! — O homem agitou os braços. — Você aí! Sim, você! Segure essa caixa depél

        — Estou tentando ir para a Islã Sorna — ela disse, insistindo. Ouvindo isso, o homem mudou completamente. Virou-se

        devagar para ela.

        — Islã Sorna? — perguntou. — Não teria nenhuma ligação com o Dr. Levine, teria?

        — Sim, tenho.

        — Ora, vejam só — disse ele com um sorriso largo e acolhedor. — Vejam só! — Estendeu a mão. — Sou Lewis Dodgson, da Biosyn Corporation, de Cupertino. Este é o meu sócio, Howard King.

        —  Oi — disse o outro homem, inclinando a cabeça. Howard King era jovem e, pelos padrões da Califórnia, bonito.

        Sarah conhecia o tipo: um clássico animal macho beta, subserviente até os ossos. E havia algo estranho no seu comportamento para com ela. Ele se afastou um pouco e parecia tão pouco à vontade na sua presença quanto Dodgson agora se mostrava amistoso.

        — E lá adiante — continuou Dodgson, apontando para o cais — está nosso outro sócio, George Baselton.

        Harding viu um homem forte inclinado sobre as caixas que estavam sendo levadas para bordo, com as mangas da camisa molhadas de suor.

        — Vocês todos são amigos de Richard? — ela perguntou.

        — Estamos indo ao encontro dele, neste momento, para ajudá-lo. — Dodgson hesitou e franziu a testa. — Mas, bem, ele não nos falou a seu respeito...

        Então Sarah imaginou qual a impressão que deviam ter dela. Uma mulher pequena, de trinta anos, com uma camisa amassada, short caqui e botas pesadas. A roupa suja e o cabelo despenteado depois de todo aquele tempo de vôo.

        — Eu conheço Richard por Ian Malcolm. Lane eu somos velhos amigos.   

        — Compreendo... — Continuou a olhar atentamente para ela, como se ainda não tivesse muita certeza.

        Sarah achou que devia explicar.

        — Eu estive na África. Resolvi vir para cá na última hora. O Dr. Thorne me telefonou.

        —  Oh, é claro. Thorne. — O homem balançou a cabeça afirmativamente e pareceu mais tranqüilo, como se agora tudo estivesse claro.

        — Richard está bem? — ela perguntou.

        —  Eu espero que sim, porque estamos levando todo este equipamento para ele.

        — Vão para Sorna agora?

        —  Iremos se o tempo continuar assim — disse Dodgson, olhando para o céu. — Estaremos prontos em cinco minutos. Será bem-vinda se quiser vir conosco — disse, amavelmente. — Teremos prazer em sua companhia. Onde está sua bagagem?

        — Tenho só isto — disse ela, erguendo a mochila.

        — Viajando com pouco peso, hein? Tudo bem, Srta. Harding, bem-vinda ao grupo.

        Ele parecia amável e sincero agora, uma mudança completa da sua atitude do início. Mas ela notou que o homem bonito, King, continuava visivelmente constrangido. Deu as costas para Sarah e entrou em atividade, gritando com os trabalhadores para que tivessem cuidado com os engradados, onde estava escrito "Biosyn Corporation". Sarah teve a impressão de que King evitava olhar para ela. E ainda não tinha visto bem o terceiro homem, no convés do barco. Sarah hesitou.

        — Tem certeza de que está tudo bem...?

        — E claro que sim! Ficaremos encantados — disse Dodgson. — Além disso, de que outro modo você vai chegar lá? Não há aviões. O helicóptero se foi.

        — Eu sei, já verifiquei.

        — Pois então. Se quiser chegar à ilha, tem de ir conosco. Sarah olhou para o jipe no barco e disse:

        — Acho que Thorne já deve estar lá, com o equipamento. Ouvindo isso, o segundo homem virou rapidamente a cabeça, alarmado. Mas Dodgson disse calmamente:

        —  Sim, acho que sim. Ele partiu ontem à noite, se não me engano.

        — Foi o que ele me disse.

        — Certo. — Dodgson balançou a cabeça afirmativamente. — Então ele já está na ilha. Pelo menos, espero que esteja.

        Ouviram gritos em espanhol e um capitão com um macacão sujo apareceu no convés.

        — Senor Dodgson, estamos prontos.

        — Ótimo — disse Dodgson. — Excelente. Suba a bordo, Srta. Harding. Vamos embora!

       

       KING

        Soltando fumaça negra, o barco pesqueiro saiu do porto para mar aberto. Howard King sentiu a vibração dos motores sob os pés, ouviu o rangido da madeira e as vozes da tripulação, falando espanhol. Olhou para trás, para Puerto Cortês, um amontoado de casas pequenas à beira d'água. Esperava que aquele maldito barco pudesse enfrentar o mar — porque estavam lá fora no meio do nada.

        E Dodgson estava se aventurando. Desafiando o destino outra vez.

        Era a situação que King mais temia.

        Howard King conhecia Lewis Dodgson há quase dez anos, desde quando entrara para a Biosyn, recém-formado na Berkeley, um jovem promissor no ramo da pesquisa, com energia para conquistar o mundo. Sua tese de doutorado foi sobre os fatores de coagulação do sangue. Entrou para a Biosyn numa época em que era imenso o interesse por esses fatores, que pareciam ser a chave para dissolver os coágulos nos pacientes com ataques cardíacos. Havia uma competição entre as empresas de biotecnologia para a descoberta de um medicamento capaz de salvar vidas e ao mesmo tempo proporcionar fortunas.

        Inicialmente, King trabalhou com uma substância promissora chamada Hemaglutina V-5 ou HGV-5. Nos primeiros testes ela dissolveu, com precisão extraordinária, a agregação das plaquetas. King tornou-se o jovem pesquisador mais promissor da Biosyn. Seu retrato apareceu com destaque no relatório anual. Tinha um laboratório próprio e um orçamento de quase meio milhão de dólares.

        Então, quando menos esperava, tudo foi por água abaixo. Nos testes preliminares com seres humanos, o HGV-5 não dissolveu os coágulos nem nos casos de enfartes do miocárdio nem nos de embolia pulmonar. Pior ainda, produziu efeitos colaterais muito graves, hemorragia gastrointestinal, erupções cutâneas, problemas neurológicos. Depois que um paciente teve convulsões e morreu, a empresa suspendeu os testes. Em poucas semanas, King perdeu seu laboratório para um pesquisador holandês recém-chegado que estava desenvolvendo um extrato da saliva da sanguessuga de Sumatra, projeto que parecia mais promissor.

        King passou para um laboratório menor, resolveu que estava farto de fatores sangüíneos e voltou sua atenção para os analgésicos. Ele tinha um composto interessante, o L-isômero de proteína de uma espécie de sapo da África, que parecia ter um efeito narcótico. Mas havia perdido a antiga confiança e, quando a empresa analisou seu trabalho, concluiu que sua pesquisa não era suficientemente documentada para merecer a aprovação da FDA para o início dos testes. Seu projeto com os sapos com chifres foi cancelado.

        King estava então com trinta e cinco anos e com dois fracassos. Seu retrato já não enfeitava o relatório anual. Correu o boato de que provavelmente seria despedido no próximo período de avaliação da empresa. Quando ele propôs um novo projeto, foi rejeitado imediatamente. Foi um período ruim da sua vida.

        Até o dia em que Lewis Dodgson o convidou para almoçar.

        Dodgson tinha uma reputação pouco favorável entre os pesquisadores porque tirava o trabalho de outros, quando estava ainda no começo, e o aprimorava dizendo que era seu. Antigamente, King jamais permitira que o vissem na companhia de Dodgson. Mas agora permitiu que ele o levasse a um caro restaurante de frutos do mar em San Francisco.

        —  A pesquisa é um trabalho duro — Dodgson disse, muito compreensivo.

        — Nenhuma novidade — disse King.

        —  Duro e arriscado — observou Dodgson. — O fato é que pesquisa inovadora raramente tem sucesso. Mas os empresários entendem isso? Não. Se a pesquisa falha, você é o culpado. Não é justo.                                                                                

        — Está dizendo isso para mim?

        — Mas esse é o jogo. - Dodgson deu de ombros e comeu uma perna de caranguejo de casca mole.                                       

        King não disse nada.

        —  Eu, pessoalmente não gosto de me arriscar — continuou Dodgson. — E todo trabalho original é arriscado. A maior parte das idéias novas não é boa, e a maior parte do trabalho original fracassa. Essa é a realidade. Se você quer fazer um trabalho original, deve esperar o fracasso. Está tudo bem quando você trabalha numa universidade, onde o fracasso é louvado e o sucesso leva ao ostracismo. Mas na indústria... não, não. O trabalho original, na indústria, não é uma escolha sensata para fazer carreira. Só vai criar problemas. Por isso estamos aqui agora, meu amigo.

        — O que posso fazer? — disse King.

        —  Bem, eu tenho a minha versão do método científico que chamo de desenvolvimento de pesquisa focalizada. Se apenas umas poucas idéias forem boas, no fim, por que tentar descobri-las? É muito difícil. Deixe que outros as descubram, deixe que eles corram o risco, deixe que eles procurem o que chamam de glória. Eu prefiro esperar e desenvolver as idéias que já demonstraram alguma promessa. Tire o que é bom e faça com que fique melhor. Ou pelo menos faça com que fique suficientemente diferente para ser patenteado. Então, é minha propriedade. Então, ela me pertence.

        King estava atônito. Dodgson admitia francamente que era um ladrão. Não parecia nem um pouco constrangido. King fingiu dar atenção à salada por algum tempo.

        — Por que está me contando isso?

        — Porque vejo alguma coisa em você. Vejo ambição. Ambição frustrada. Ouça minhas palavras, Howard, você não precisa se sentir frustrado. Não precisa nem mesmo ser despedido da empresa na próxima avaliação dos trabalhos. O que certamente vai acontecer. Que idade tem seu filho?

        — Quatro — disse King.

        — E terrível ficar sem trabalho com uma família jovem. E não vai ser fácil conseguir outro emprego. Quem vai lhe dar chance agora? Aos trinta e cinco anos, um cientista já deixou sua marca, ou nunca mais vai deixar. Não estou dizendo que isso seja certo, mas é como eles pensam.

        King sabia que era assim que eles pensavam. Em todas as empresas de biotecnologia da Califórnia.

        —  Mas, Howard — Dodgson inclinou-se sobre a mesa e abaixou a voz —, um mundo maravilhoso o espera, se resolver ver as coisas de modo diferente. Há um outro modo de viver sua vida. Francamente, eu acho que deve pensar no que estou dizendo.

        Duas semanas depois King passou a ser assistente pessoal de Dodgson no Departamento de Tendências Biogênicas Futuras, que era como a Biosyn chamava o trabalho de espionagem industrial. E nos anos seguintes, King mais uma vez subiu de conceito na Biosyn — agora porque Dodgson gostava dele.

        Agora King tinha todo o equipamento do sucesso. Um Porsche, uma hipoteca, um divórcio, um filho que ele via nos fins de semana. Tudo porque King provou ser o perfeito segundo em comando, fazendo horas extras, encarregando-se dos detalhes, mantendo seu patrão de fala apressada fora de encrencas. E nesse processo King veio a conhecer todos os lados de Dodgson — o lado carismático, o lado visionário e o lado impiedoso. King dizia a si mesmo que podia lidar com o lado impiedoso, que podia controlá-lo, que durante aqueles anos tinha aprendido a fazer isso.

        Mas às vezes não tinha certeza.

        Como agora.

        Porque estavam ali naquele barco de pesca malcuidado e fedido, no meio do oceano, partindo de uma pobre cidadezinha da Costa Rica, e no último e tenso momento Dodgson tinha resolvido fazer uma espécie de jogo, conhecendo aquela mulher e levando-a com eles.

        King não sabia qual era a intenção de Dodgson, mas via nos olhos dele aquele brilho intenso que vira poucas vezes antes e que muito o alarmava.

        A mulher, Harding, estava agora no convés de proa, olhando para longe, para o oceano. King viu Dodgson perto do jipe e acenou para ele nervosamente.

        — Escute — King disse. — Precisamos conversar.

        — Certo — disse Dodgson, com a maior calma. — De que se trata? E ele sorriu. Com aquele sorriso encantador.     

       

       HARDING

        Sarah Harding olhava para o céu cinzento e ameaçador. O barco balançava nas marolas altas, longe da costa. A tripulação corria para firmar as amarras do jipe que ameaçava soltar-se a cada movimento mais forte do barco. Ela estava na proa, lutando contra o enjôo. Ao longe, no horizonte, via vagamente a linha escura, o primeiro sinal da Islã Sorna.

        Olhou para trás e viu Dodgson e King debruçados na amurada, no centro do barco, conversando animadamente. King gesticulava, agitado. Dodgson ouvia e balançava a cabeça. Depois passou o braço pelos ombros de King, tentando acalmá-lo. Os dois ignoravam a atividade em volta do jipe. O que era estranho, pensou ela, considerando todo o nervosismo demonstrado quando estavam carregando o equipamento. Agora, pareciam não se importar.

        Sarah tinha reconhecido o terceiro homem, Baselton, e ficou surpresa por encontrá-lo ali, naquele pequeno barco de pesca. Baselton apertou a mão dela secamente, quando foram apresentados, e desapareceu na cabine do barco assim que deixaram o porto. Mas talvez estivesse enjoado também.

        Continuou a observar os dois homens e viu Dodgson se afastar apressadamente de King para supervisionar o trabalho da tripulação. King verificou as tiras que prendiam as caixas e os tambores no convés da proa. As caixas onde estava escrito Biosyn.

        Harding nunca ouvira falar da Biosyn Corporation. Tentava imaginar qual podia ser a ligação de Richard com ela. Sempre que Ian falava nas empresas de biotecnologia, fazia-o em tom de crítica, até mesmo de desprezo. E aqueles homens não pareciam do tipo de amigos de Malcolm. Eram rígidos demais, muito... sinistros.

        Mas, pensou ela, Ian tinha amigos estranhos que viviam aparecendo no seu apartamento — um calígrafo japonês, um grupo teatral da Indonésia, um malabarista de Las Vegas com seu bolero brilhante, aquele estranho astrólogo francês que acreditava que a terra era oca... E seus amigos matemáticos. Eram realmente doidos. Pelo menos pareciam doidos para ela. Tinham uma expressão tão distante, sempre ocupados com suas provas. Páginas e páginas de provas, centenas às vezes. Era tudo tão abstrato para ela. Sarah Harding gostava de tocar a terra, ver os animais, sentir os sons e os cheiros. Isso era real para ela. Tudo o mais não passava de teorias, possivelmente certas, possivelmente erradas.

        As ondas começaram a bater com força na proa, e ela se afastou um pouco para não se molhar. Bocejou. Não tinha dormido muito nas últimas vinte e quatro horas. Dodgson terminou o trabalho com o jipe e caminhou em direção a ela.                                          

        — Tudo bem? — Sarah perguntou.

        —  Oh, sim. — Ele sorriu, alegremente.

        — Seu amigo King parecia agitado.                                     

        — Ele não gosta de barcos. — Inclinou a cabeça, indicando as marolas altas. — Mas estamos indo mais depresssa agora. Dentro de uma hora, mais ou menos, estaremos lá.

        — Diga-me, o que é a Biosyn Corporation? — ela perguntou. — Nunca ouvi falar nessa empresa.

        —  É uma empresa pequena. Fazemos o que chamam de produtos biológicos para o consumidor. Nós nos especializamos em organismos recreativos e esportivos. Por exemplo, criamos novos tipos de truta e outros peixes. Estamos criando novos tipos de cães, menores, para apartamento. Esse tipo de coisa.

        Exatamente o tipo de coisa que Ian detestava, pensou Sarah.

        — Como conheceu Ian?

        — Oh, há muito tempo — disse Dodgson. Sarah notou a evasiva.

        — Quanto tempo?

        — Desde os dias do parque.

        —  O parque — ela disse.                                 

        — Ele nunca contou como machucou a perna?

        — Não — disse Sarah. — Nunca fala sobre isso. Disse apenas que aconteceu num trabalho de consultoria que estava fazendo... eu não sei. Um problema. Era um parque?

        — Sim, de certo modo. — Dodgson olhou para o mar. Depois de um momento, deu de ombros. — E você? Como o conheceu?

        — Ele foi um dos orientadores da minha tese. Sou etologista. Estudo os grandes mamíferos nos ecossistemas da planície do Leste da África. Carnívoros em particular.

        — Carnívoros?

        — Estou estudando as hienas — disse ela. — Antes, estudei os leões.

        — Faz isso há muito tempo?

        —  Quase dez anos, agora. Seis anos continuamente, desde o meu doutorado.

        — Interessante — disse Dodgson, fazendo um gesto afirmativo. — E veio da África para cá?

        — Sim, de Seronera. Tanzânia.

        Dodgson balançou a cabeça com olhar vago e olhou na direção da ilha, por cima do ombro dela.

        — Veja. Parece que o tempo vai melhorar, afinal.

        Sarah olhou e viu faixas azuis no manto fino de nuvens. O sol tentava se mostrar. O mar estava mais calmo. E, com surpresa, ela viu a ilha muito mais perto. Dava para ver os penhascos erguendo-se do mar. Penhascos de rocha vulcânica avermelhada, quase transparentes.

        —  Tanzânia — disse Dodgson. — Você dirige uma grande equipe de pesquisa?

        —  Não. Trabalho sozinha.                                                         

        — Sem alunos?                                                                 

         —  Infelizmente, não. Isso porque meu trabalho não é muito atraente. Os grandes carnívoros da savana na África são quase todos noturnos. Desse modo, a minha pesquisa é feita geralmente à noite.

        — Deve ser duro para seu marido.

        — Oh, eu não sou casada. — Ela deu de ombros.

        — Isso me surpreende. Afinal, uma mulher bonita como você...

        —  Eu nunca tive tempo — Sarah disse, rapidamente. E para mudar de assunto perguntou: — Onde se pode aportar nesta ilha?

        Dodgson olhou para a ilha. Dava para ver as ondas quebrando, altas e brancas, contra a base dos rochedos. Estavam a duas ou três milhas da ilha.

        — E uma ilha diferente — disse Dodgson. — Toda a região da América Central é vulcânica. Existem cerca de trinta vulcões ativos entre o México e a Colômbia. Todas essas ilhas ao largo da costa foram antigamente vulcões ativos, uma parte da cadeia central. Mas, ao contrário do continente, as ilhas estão agora inativas. Há milhares de anos não há uma erupção.

        —  Então estamos vendo a parte externa de uma cratera?

        —  Exatamente. Os rochedos são todos resultado da erosão provocada pela água da chuva, mas o oceano se encarrega da erosão na base dos rochedos. Aquelas partes planas do rochedo que está vendo são onde o mar desgastou a rocha e áreas enormes da face do rochedo desmoronaram e caíram no mar. Tudo é de rocha vulcânica macia.

        —  Então, vamos desembarcar...

        —  Há vários lugares no lado do vento onde o oceano abriu cavernas na rocha. Em dois desses lugares, as cavernas chegam até os rios que correm no interior da ilha. Portanto, pode-se passar por elas. — Apontou para a frente. — Está vendo ali? Dá para ver uma das cavernas.

        Sarah Harding viu uma abertura escura e irregular na base do rochedo. Em volta dela, as ondas quebravam na rocha, a espuma branca subindo a quase quinze metros de altura.

        —  Vamos entrar com este barco naquela caverna?

        — Se o tempo continuar como está, vamos. — Dodgson olhou para o mar. — Não se preocupe, não é tão ruim quanto parece. Mas... estava falando sobre a África. Quando saiu da África?

        — Logo depois que o Dr. Thorne telefonou. Disse que ia com Ian tentar salvar Richard e perguntou se eu queria ir também.

        — E o que você disse?

        — Disse que ia pensar. Dodgson pensou por um momento.

        — Não disse a ele que viria?

        —  Não. Não estava certa de querer vir. Quero dizer, estou muito ocupada. Tenho meu trabalho. E era uma longa viagem.

        — Por um antigo amor — disse Dodgson, balançando a cabeça compreensivamente.                                                               

        Sarah suspirou.                                                                 

        — Bem. Você conhece Ian.

        — Sim, eu conheço Ian — disse Dodgson. — Um tipo e tanto.

        — Esse é um modo de descrevê-lo.

        Depois de um silêncio constrangedor, Dodgson disse:

        — Estou confuso. A quem exatamente você disse que viria?

        — A ninguém. Tomei o primeiro avião e aqui estou.

        — Mas e a universidade, seu colegas... Sarah deu de ombros.

        —  Não tive tempo. E, como eu disse, trabalho sozinha. — Olhou outra vez para a ilha. O rochedo se erguia muito acima do barco. Estavam apenas a uma centena de metros da costa. A caverna parecia muito maior agora, com as ondas batendo violentamente nos dois lados. Sarah balançou a cabeça. — Parece bastante difícil.

        —  Não se preocupe — Dodgson disse outra vez. — Veja, o capitão já está indo para a caverna. Assim que entrarmos, estaremos a salvo. E então... Vai ser uma bela aventura.

        O barco balançou e afundou a proa, num movimento incerto. Sarah segurou na amurada com força. Dodgson disse, com um largo sorriso.

        —  Vê o que eu digo? Uma aventura e tanto, não é? — Ele parecia de repente cheio de energia, agitado mesmo. Esfregou as mãos. — Não precisa se preocupar, Srta. Harding. Não vou deixar que nada aconteça a...

        Sarah não sabia do que ele estava falando, mas, antes que tivesse tempo de perguntar, o barco mergulhou a proa outra vez, espirrando água, e ela cambaleou. Dodgson se inclinou rapidamente para o lado — como para evitar que ela caísse —, mas aparentemente alguma coisa saiu errada — o corpo dele bateu nas pernas de Sarah, levantando-a —, outra onda os atingiu e Sarah dobrou o corpo, gritou e agarrou na amurada. Mas tudo estava acontecendo depressa demais, o mundo virou de cabeça para baixo e girou em volta dela, sua cabeça bateu na amurada e então ela se viu caindo, despencando no espaço. Viu a tinta descascada da proa do barco passar por ela, viu o oceano verde erguendo-se à sua frente e um frio gelado a envolveu quando mergulhou no mar encapelado e afundou na escuridão.

       

       O VALE

        — Tudo está indo muito bem — disse Levine, esfregando as mãos.

        — Melhor do que eu esperava, devo dizer. Estou muito satisfeito.

        Estava no posto de observação com Thorne, Eddie, Malcolm e os meninos, olhando para o vale lá embaixo. Todos estavam transpirando dentro da pequena casa no alto do andaime, no ar quente e parado do meio-dia. Em volta deles, a planície de relva estava deserta. A maioria dos dinossauros tinha se retirado para a sombra fresca das árvores.

        A única exceção era o bando de apatossauros que deixou as árvores e voltou ao rio para beber outra vez. Os animais enormes formavam um grupo compacto na margem do rio. Perto dali, porém mais espalhados, estavam os parassauros, os menores mais próximos do bando de apatossauros.

        Thorne enxugou o suor da testa e perguntou:

        —  Com o quê, exatamente, estão tão satisfeitos?

        —  Com o que estamos vendo aqui. — Malcolm consultou o relógio e escreveu alguma coisa no seu bloco de anotações. — Estamos conseguindo os dados de que precisávamos. É muito excitante.

        Thorne bocejou. O calor dava sono.

        — Por quê? Os dinossauros estão tomando água. O que há de especial nisso?

        — Estão bebendo outra vez — corrigiu Levine. — Pela segunda vez numa hora. No meio do dia. Essa absorção de líquido é extremamente sugestiva das estratégias termorreguladoras usadas por essas enormes criaturas.

        — Quer dizer que eles bebem bastante para não sentir calor — disse Thorne, sempre impaciente com qualquer terminologia pedante.

        — Sim. É evidente que sim. Eles bebem muito. Mas na minha opinião, sua volta ao rio pode ter outro significado completamente diferente.

        —  Qual?

        — Ora, ora. — Levine apontou para os animais. — Olhe para as manadas. Veja como estão dispostas em termos de espaço. Estamos vendo uma coisa que ninguém jamais viu antes ou sequer suspeitou em se tratando de dinossauros. Estamos vendo nada mais, nada menos do que uma simbiose entre as espécies.

        — Estamos vendo isso?

        — Sim — afirmou Levine. — Os apatossauros e os parassauros estão juntos. Eu os vi juntos ontem também. Aposto que sempre ficam juntos quando estão na planície aberta. Sem dúvida, vocês estão se perguntando por quê.

        — Sem dúvida — disse Thorne.

        — O motivo — explicou Levine — é que os apatossauros são muito fortes mas têm a visão fraca, ao passo que os parassauros são menores, mas têm visão muito aguda. Assim as duas espécies ficam juntas para a defesa mútua. Exatamente como as zebras e os babuínos ficam juntos na planície africana. A zebra tem bom faro e os babuínos boa visão. Juntos, são mais eficazes contra os predadores.

        — E você acha que isso também acontece com os dinossauros porque...

        — É perfeitamente óbvio — disse Levine. — Observe o comportamento deles. Quando as duas manadas estão separadas, formam grupos fechados. Mas, quando estão juntas, os parassauros se espalham, abandonando sua formação para formar um anel em volta dos apatossauros. Exatamente como estão agora. Isso só pode significar que cada parassauro vai ser protegido pelo bando dos apatossauros e vice-versa. Só pode ser uma defesa mútua contra predadores.

        Um dos parassauros levantou a cabeça e olhou para a outra margem do rio. Todos os outros parassauros fizeram o mesmo. Os apatossauros continuaram a beber e apenas um ou dois adultos levantaram o pescoço.

       

        No calor do meio-dia, os insetos zumbiam em volta deles. Thorne disse:

        — Então, onde estão os predadores?

        — Bem ali. — Malcolm apontou para um grupo de árvores no outro lado do rio, não muito distante da água.

        Thorne olhou e não viu nada.

        — Não está vendo?                             

        — Não.

        — Continue olhando. São animais pequenos parecidos com lagartos. Marrom-escuros. Raptores — disse Malcolm.

        Thorne deu de ombros. Não via nada. Levine, ao lado dele, começou a comer uma barra de alimento energético. Preocupado em segurar o binóculo, deixou cair o papel no assoalho da pequena casa. Pedaços do papel voaram para baixo, para o chão.

        —  Que tal essa coisa? — Arby perguntou.

        —  E boa. Um pouco açucarada.

        — Tem mais?

        Levine procurou nos bolsos e deu uma barra para Arby que a partiu ao meio e deu a metade para Kelly. Ele desembrulhou sua metade cuidadosamente, dobrou o papel e guardou no bolso.

        —  Vocês compreendem a importância disso? — perguntou Malcolm. — Para a questão da extinção. Já é evidente que a extinção dos dinossauros é um problema muito mais complexo do que julgávamos até agora.

        — É mesmo? — perguntou Arby.

        — Bem, pense um pouco. Todas as teorias sobre extinção têm como base os registros fósseis. Mas esses registros não mostram o tipo de comportamento que estamos vendo aqui. Não registram a complexidade da interação dos grupos.

        — Porque os fósseis são apenas ossos — disse Arby.

        —  Certo. E ossos não têm comportamento algum. Pensando bem, o registro fóssil é como uma série de fotografias, momentos congelados de uma realidade móvel e viva. Olhar os registros fósseis é como folhear um álbum de retratos de família. Sabemos que o álbum não é completo. Sabemos que a vida aconteceu entre as fotos. Mas não temos registro do que aconteceu, temos somente as fotos. Então, nós as estudamos e estudamos. E logo começamos a pensar no álbum não como uma série de momentos, mas como a própria realidade. E começamos a explicar tudo em termos do álbum e esquecemos da realidade que está por baixo das fotos.

        — E a tendência — continuou Malcolm — tem sido pensar em termos dos fatos físicos. Supomos que algum fato físico externo tenha sido responsável pela extinção. Um meteoro que atinge a Terra e altera a temperatura. Ou vulcões entram em erupção e mudam a temperatura. Ou um meteoro provoca a erupção dos vulcões e muda a temperatura. Ou a vegetação muda, os animais morrem de fome e são extintos. Ou surgem plantas que envenenam todos os dinossauros. Em cada caso, o que se imagina é sempre um evento externo. Mas o que ninguém imagina é que os próprios animais tenham mudado — não nos ossos, mas de comportamento. Contudo, olhando para animais como aqueles e vendo o modo complexo como seu comportamento se entrelaça, compreendemos que uma mudança no comportamento do grupo pode facilmente levar à extinção.

        — Mas, por que haveria uma mudança no comportamento do grupo? — perguntou Thorne. — Se não houvesse nenhuma catástrofe externa, o comportamento teria mudado?

        —  Na realidade — disse Malcolm — o comportamento está sempre mudando. Nosso planeta é dinâmico. O clima está mudando. A Terra está mudando. Os continentes se movem lentamente. Oceanos aumentam e diminuem. Montanhas surgem do solo e são desfeitas pela erosão. Todos os organismos do planeta estão se adaptando constantemente a essas mudanças. Os melhores são os que se adaptam com maior rapidez. Por isso é difícil compreender como uma catástrofe que produz uma grande mudança pode causar a extinção, uma vez que grandes mudanças estão acontecendo o tempo todo.

        — Nesse caso — disse Thorne —, o que causa a extinção?

        —  Certamente não uma mudança rápida, os fatos nos dizem isso claramente — respondeu Malcolm.

        — Quais fatos?

        —  Cada mudança ambiental importante quase sempre foi acompanhada por uma onda de extinção — mas não imediatamente. As extinções ocorrem centenas de milhares de anos depois. As geleiras desceram, o clima mudou drasticamente, mas os animais não morreram. Só depois que as geleiras recuaram, quando se pensava que tudo ia voltar ao normal, várias espécies começaram a ser extintas. Foi quando as girafas, tigres e mamutes desapareceram do continente americano. E esse é o padrão comum. E quase como se as espécies tivessem enfraquecido por causa da grande mudança, mas só vieram a morrer muitos anos depois. É um fenômeno perfeitamente aceito e observado.                         

        — E como se explica? Levine ficou calado.

        —  Não há explicação — disse Malcolm. — É um mistério paleontológico. Mas acredito que a teoria da complexidade possa nos dizer muita coisa. Porque se o conceito da vida no limite do caos é verdadeiro, então uma grande mudança leva os animais para mais perto dessa margem. Desestabiliza todo tipo de comportamento. E, quando o meio ambiente volta ao normal, não é na verdade uma volta ao normal. Em termos de evolução, é outra grande mudança e forte demais para ser acompanhada. Acho que o novo comportamento das populações pode surgir de modos inesperados e acho que sei por que os dinossauros...

        —  O que é aquilo? — perguntou Thorne.

        Ele estava olhando para as árvores e viu um dinossauro saltar para a clareira. Era magro, movia-se agilmente apoiado nas patas traseiras, mantendo o equilíbrio com a cauda rígida. Tinha quase dois metros de altura, era marrom-escuro com listras vermelhas, como um tigre.

        — Aquilo... é um velocirraptor — disse Malcolm. Thorne voltou-se para Levine.

        — Foi isso que o fez subir na árvore? Parece muito feio.

        —  Eficiente — disse Levine. — Esses animais são máquinas mortíferas brilhantemente construídas. Sem dúvida é o predador mais eficiente da história do planeta. Aquele que acaba de sair da selva deve ser o animal alfa. Ele guia o grupo.

        Thorne viu outro movimento debaixo das árvores.

        — Há outros.

        — Oh, sim — disse Levine. — Este grupo é muito grande. — Apanhou o binóculo. — Eu gostaria de localizar seu ninho. Não o encontrei em nenhum lugar da ilha. É claro que eles procuram se esconder muito bem, mas mesmo assim...

        Os parassauros estavam gritando estridentemente, chegando mais perto do bando de apatossauros. Mas os grandes apatossauros pareciam relativamente indiferentes. Os adultos que estavam mais próximos da água chegaram a dar as costas para o raptor.

        — Eles não se importam? — perguntou Arby. — Não estão nem olhando para ele.

        — Não se deixe enganar — disse Levine. — Os apatossauros se importam e muito. Podem parecer vacas gigantes, mas não são nada disso. Aquelas caudas têm dez metros de comprimento e pesam algumas toneladas. Vejam com que rapidez eles as balançam. Uma pancada com aquela cauda pode quebrar as costas do atacante.

        — Então, dar as costas faz parte da sua defesa?

        —  Sem dúvida. E pode-se ver que o pescoço longo ajuda a manter o equilíbrio da cauda.

        As caudas dos adultos eram tão longas que chegavam até a outra margem do rio. Eles as balançavam de um lado para o outro, os parassauros gritavam e o raptor que vinha na frente voltou para as árvores. Logo depois, todo o grupo começou a se afastar, seguindo a margem da floresta, na direção das colinas.

        — Parece que você estava certo — disse Thorne. — As caudas espantaram os raptores.

        — Quantos você pode contar? — perguntou Levine.

        — Não sei. De dez a doze. Posso ter deixado passar alguns.

        — Quatorze. — Malcolm anotou no seu caderno.

        — Quer segui-los? — perguntou Levine.

        — Agora não.

        — Podemos ir no Explorer.

        — Talvez mais tarde — disse Malcolm.

        —  Acho que precisamos saber onde fica o ninho deles — insistiu Levine. — É essencial, Ian, se vamos determinar o relacionamento predador-presa. Nada é mais importante do que isso. E esta é a oportunidade perfeita para seguir...

        — Talvez mais tarde — disse Malcolm, consultando o relógio outra vez.

        — É a centésima vez que você consulta as horas hoje — disse Thorne.

        Malcolm deu de ombros.

        — Está quase na hora do almoço. A propósito, e Sarah? Ela não devia estar chegando?

        — Sim. Imagino que deva chegar a qualquer momento — disse Thorne.

        Malcolm enxugou o suor da testa.                        

        — Está quente aqui em cima.                            

        — Sim, está quente.

        Ouviam o zumbido dos insetos no sol enquanto observavam a retirada dos raptores.

        — Sabe o que estou pensando? — disse Malcolm. — Acho que devemos voltar.

        — Voltar? — exclamou Levine. — E as nossas observações? E as outras câmeras que queremos instalar e...

        — Eu não sei, talvez fosse bom descansar um pouco. Levine olhou incrédulo para ele mas não disse nada. Thorne e os meninos olharam também para Malcolm, em silêncio.

        —  Bem, eu acho — disse Malcolm — que, como Sarah está vindo de tão longe, da África, devemos estar lá para recebê-la. — Deu de ombros. — Acho que seria uma simples cortesia.

        —  Eu não sabia que... — disse Thorne.

        —  Não, não — Malcolm disse, rapidamente. — Não é nada disso. É só que... Você sabe, talvez ela nem venha... — de repente pareceu incerto. Ela disse que viria?

        — Disse que ia pensar. Malcolm franziu a testa.

        — Então ela vem. Se Sarah disse isso, ela vem. Eu a conheço. Então, querem voltar agora?

        —  E claro que não — disse Levine, ainda olhando com o binóculo. — Eu nem pensaria em sair daqui agora.

        — Thorne? Quer voltar? — Malcolm perguntou.

        — Claro. — Thorne estava enxugando o suor da testa. — Está quente.

        —  Se eu conheço Sarah — disse Malcolm, descendo pelo andaime —, ela vai chegar a esta ilha maravilhosa como sempre.

       

       A CAVERNA

        Com esforço ela chegou à superfície, mas tudo o que viu foi água — ondas de quatro metros erguiam-se acima da sua cabeça por todos os lados. Era imensa a força do oceano. O movimento da água a levava para a frente e para trás, e ela não tinha forças para resistir. Não via o barco, só o mar com a espuma branca das ondas. Não via a ilha, só água. Só água. Lutou contra a tremenda sensação de pânico.

        Tentou bater as pernas contra a corrente, mas suas botas pareciam de chumbo. Mergulhou outra vez e voltou à superfície respirando avidamente. Precisava tirar as botas. Respirou, prendeu o ar, mergulhou a cabeça e tentou desatar os cordões das botas. Seus pulmões queimavam. O oceano a levava de um lado para o outro incessantemente.

        Tirou uma das botas, voltou para respirar e mergulhou a cabeça outra vez. Com os dedos rígidos de frio e de medo, começou a desatar o cordão do outro pé. No fim do que para ela pareceram horas, suas pernas estavam livres e leves, e ela começou a mover os braços e as pernas para ficar na superfície. O movimento do mar a levantava e deixava cair. Ela não via a ilha. Sentiu pânico outra vez. Então avistou a ilha.

        Os penhascos nus estavam assustadoramente próximos. As ondas batiam com estrondo nas rochas. Ela não estava a mais de cinqüenta metros da costa, levada inexoravelmente pelas ondas para as pedras. Quando a onda seguinte a ergueu, viu a caverna, cem metros à sua direita. Tentou nadar para ela, mas era impossível. Não tinha forças para fazer nenhum movimento naquele mar cncapelado. Só sentia a força do mar, levando-a para os rochedos.

        O pânico acelerou seu coração. Sabia que seria morta instantaneamente. Uma onda se ergueu sobre sua cabeça, ela engoliu água e tossiu. Sua vista ficou turva. Sentiu náusea e um terror profundo.

        Abaixou a cabeça na água e começou a nadar, uma braçada depois da outra, batendo os pés com a maior força possível. Não tinha a sensação de movimento, só a força da corrente puxando-a para o lado. Não ousava olhar para cima. Continuou a nadar. Quando ergueu a cabeça para respirar, viu que tinha avançado um pouco — não muito, mas um pouco — para o norte. Estava mais perto da caverna.

        Isso a animou, mas continuava apavorada. Estava perdendo as forças. Seus braços e suas pernas doíam com o esforço, os pulmões estavam em fogo. A respiração curta e áspera. Tossiu outra vez, respirou fundo, abaixou a cabeça e continuou a nadar.

        Mesmo com a cabeça na água ela ouvia o rugido surdo das ondas contra o rochedo. Nadou com todas as forças. A corrente e as ondas a levavam para a direita e para a esquerda, para a frente e para trás. Era inútil. Mesmo assim ela tentou.

        Aos poucos a dor aguda nos músculos se transformou numa dor surda e contínua. Era como se tivesse vivido com ela toda a sua vida. Já não a notava mais. Continuou a nadar, sem pensar em nada.

        Quando a marola a levantou outra vez, ergueu a cabeça para respirar. Surpresa, viu que a caverna estava muito perto. Mais algumas braçadas, a água a carregaria para dentro. Imaginou que na caverna a corrente devia ser mais fraca. Mas não era, nos dois lados da entrada, as ondas altas batiam com força, subindo pela rocha e voltando no repuxo. O barco não estava em lugar algum.

        Abaixou a cabeça outra vez e nadou, usando suas últimas forças, e de repente uma marola imensa a apanhou, erguendo-a e levando-a para as pedras. Já não tinha forças para resistir. Levantou a cabeça e viu que tudo estava escuro.

        Exausta e dolorida, compreendeu que estava dentro da caverna. O mar a havia levado para a caverna! O som das ondas ecoava nas paredes de pedra. Estava escuro demais para ver alguma coisa. A corrente a levava cada vez mais para dentro com uma força incrível. Ofegante, ela tentou nadar numa direção, mas não conseguia. Bateu contra as rochas, sentiu uma dor lancinante e foi carregada para o interior da caverna. Mas agora havia uma diferença. Via uma luz fraca no teto e a água em volta dela parecia brilhar. A força do mar diminuiu. Era mais fácil manter a cabeça fora da água. Viu luz à frente, brilhante e quente — o fim da caverna.

        Então, de repente, foi carregada para a luz do sol e para o ar livre. Estava no meio de um rio largo e lamacento, rodeado por folhagem densa. O ar era quente e parado. Ouviu as vozes distantes dos pássaros.

        Além de uma curva do rio ela viu a popa do barco de Dodgson, já ancorado. Não via ninguém no barco e não queria ver.

        Reunindo as forças que restavam, ela nadou para a margem e agarrou os arbustos cerrados. Fraca demais, passou o braço em volta de uma raiz e deitou de costas na corrente suave, olhando para o céu, tentando fazer a respiração voltar ao normal. Não sabia quanto tempo ficou assim até sentir que as forças voltavam. Segurando nas raízes, subiu para a margem, até chegar a uma abertura na folhagem, que dava para uma praia lamacenta adiante. Quando se arrastou para o alto da margem escorregadia, notou várias pegadas grandes na lama. Eram estranhas, marcas de pés de três dedos, cada um terminando numa garra longa...

        Abaixou para examinar as pegadas e sentiu a terra vibrar, tremer sob suas mãos. Uma sombra enorme desceu sobre ela e, ao erguer os olhos, viu atônita a barriga pálida e encouraçada de um animal enorme. Estava fraca demais para reagir, até para levantar a cabeça.

        A última coisa que viu foi um pé enorme de pele dura como couro pousar ao seu lado, remexendo a lama e ao mesmo tempo ouviu um ronco baixo e surdo. Então, de repente, dominada pela exaustão, Sarah Harding perdeu as forças e caiu deitada de costas. Fechou os olhos e desmaiou.

       

       DODGSON

        Poucos metros acima da margem do rio, Lewis Dodgson subiu no jipe Wrangler feito sob encomenda e bateu a porta. Ao lado dele, Howard King retorcia as mãos, nervoso.

        —  Como pôde fazer aquilo com ela? — King perguntou.

        — Fazer o quê? — perguntou George Baselton, no banco de trás.

        Dodgson não respondeu. Girou a chave e ligou o motor. Engrenou a marcha no carro de tração nas quatro rodas e começaram a subir a colina na direção da selva, afastando-se do barco e da margem do rio.

        — Como pôde? — repetiu King, agitado. — Meu Deus.

        — O que aconteceu foi um acidente — disse Dodgson.

        — Um acidente? Um acidente ?

        — Isso mesmo, um acidente — repetiu Dodgson, calmo. — Ela caiu na água.

        — Eu não vi nada — disse Baselton.      King balançou a cabeça.

        — Jesus, e se alguém vier investigar e...

        — E daí? — interrompeu Dodgson. — O mar estava revolto, ela estava de pé na proa, uma onda enorme nos atingiu, e ela foi atirada para fora do barco. Não sabia nadar muito bem. Navegamos em círculo à procura dela, mas não encontramos. Um acidente muito infeliz. Então, por que está preocupado?

        — Por que estou preocupado?

        — Sim, Howard. Exatamente por que merda você está preocupado?

        — Pelo amor de Deus, eu vi...          

        — Não, não viu — disse Dodgson.

        — Eu não vi nada — Baselton disse outra vez. — Eu fiquei na cabine o tempo todo.

        — Ótimo para você — disse Howard King. — Mas e se houver uma investigação?

        O jipe saltava na estrada de terra, cada vezmais se embrenhando na selva.

        — Não vai haver — garantiu Dodgson. — Ela deixou a África apressadamente e não disse a ninguém para onde ia.

        —  Como você sabe? — perguntou King, com voz estridente.

        —  Sei porque ela me disse, Howard. É por isso que eu sei. Agora apanhe o mapa e pare de choramingar. Você sabia o que íamos fazer quando resolveu vir comigo.

        — Eu não sabia que você ia matar alguém, pelo amor de Deus...

        —  Howard — Dodgson suspirou. — Não vai acontecer nada. Apanhe o mapa.

        — Como você sabe?

        — Porque sei o que estou fazendo, é por isso. Ao contrário de Malcolm e Thorne, que estão em algum lugar desta ilha, rodando por aí, fazendo não sei que bobagem nesta maldita selva.

        A menção aos dois cientistas criou uma nova preocupação. King disse, mais nervoso ainda.

        — Talvez a gente os encontre...

        — Não, Howard, não vamos encontrar. Eles nunca vão saber que estamos aqui. Não vamos ficar mais de quatro horas, lembre-se disso. Desembarcar à uma hora. De volta ao barco às cinco. No porto de Costa Rica às sete. Em San Francisco à meia-noite. Pronto. Feito. Finito. E finalmente, depois de todos esses anos, vou ter o que devia ter conseguido anos atrás.

        — Embriões de dinossauros — disse Baselton.

        — Embriões? — King perguntou, surpreso.

        —  Oh, não estou mais interessado em embriões — disse Dodgson. — Anos atrás, tentei conseguir embriões congelados, mas não preciso me preocupar com isso agora. Quero ovos fertilizados. E em quatro horas eu terei ovos de todas as espécies que existem nesta ilha.                                     

        —  Como pode fazer isso em quatro horas?           

        — Posso porque já sei o local exato de cada ninho de dinossauro na ilha. O mapa, Howard.

        King abriu o mapa. Era uma carta topográfica grande de 30 por 90 cm mostrando elevações do terreno com contornos azuis. Em vários lugares nos vales, havia uma densa concentração de círculos vermelhos. Em alguns lugares, grupos de círculos.

        —  O que é isto? — perguntou King.                                

        — Por que não lê o que está escrito? — disse Dodgson.

        King leu a legenda.

        —  Sigam data Landsat/Nordstat misto spectra VSFR/FASLR/ IFFVR. E depois uma porção de números. Não, espere. Datas.

        —  Correto — disse Dodgson. — Datas.

        — Datas das passagens? Isto é uma carta resumida combinando os dados de várias passagens do satélite?

        — Correto.

        King continuou a examinar o mapa.

        —  E parece... espectro visível e abertura falsa de radar e... o quê?

        —  Infravermelho. VR termal de banda larga. — Dodgson sorriu. — Fiz tudo isso em duas horas mais ou menos. Copiei todos os dados do satélite, fiz um resumo e consegui as respostas que eu queria.

        — Já compreendi — disse King. — Esses círculos vermelhos são como assinaturas infravermelhas.

        — Sim — disse Dodgson. — Animais grandes deixam grandes marcas. Apanhei todas as passagens do satélite por esta ilha nos últimos anos e fiz um mapa dos locais das fontes de calor. E os locais se sobrepõem de passagem para passagem, o que é indicado pelas marcas vermelhas concêntricas. Significa que os animais tendem a se localizar em determinados lugares. Por quê? — Olhou para King. — Porque é aí que estão os ninhos.

        — Sim, deve ser — disse Baselton.

        — Pode ser onde eles comem — observou King.                  Dodgson balançou a cabeça, irritado.                               

        — É óbvio que esses círculos não podem indicar os lugares em que eles comem.

        — Por que não?                                      

        — Porque esses animais pesam em média vinte toneladas cada um. Se você tiver um bando de dinossauros, terá um total de biomassa com mais de duzentos e cinqüenta mil quilos andando pela floresta. Tantos animais desse tamanho comem uma enorme quantidade de plantas num dia. E o único modo de fazer isso é manter-se em movimento. Certo?

        — Acho que...

        — Você acha? Olhe à sua volta, Howard. Está vendo alguma parte da floresta sem vegetação? Não, não está. Eles comem as folhas de algumas árvores e seguem em frente. Acredite em mim, esses animais têm de se mover para se alimentar. O que eles não mudam são os locais dos ninhos. Portanto, os círculos vermelhos devem indicar onde estão os ninhos. — Olhou para o mapa. — E, a não ser que eu me engane, o primeiro ninho fica logo depois desta subida, na encosta do outro lado.

        O jipe derrapou numa poça de lama e seguiu em frente, subindo a colina.

       

       O CHAMADO

        No posto de observação, lá no alto, Levine observava os bandos de dinossauros com o binóculo. Malcolm tinha voltado para o trailer com os outros e ele estava sozinho. Na verdade foi um alívio para Levine. Estava muito satisfeito em poder observar aqueles animais e sabia que Malcolm não compartilhava seu entusiasmo. Malcolm sempre parecia estar pensando em outra coisa. E não tinha paciência para observar por muito tempo — ele queria analisar os dados, não coletá-los.

        É claro que, entre os cientistas, isso representava uma diferença bastante conhecida de personalidade. A física era um exemplo perfeito. Os experimentalistas e os teóricos viviam em mundos diferentes, trocando artigos científicos entre eles, mas na realidade com pouca coisa em comum. Era quase como se estudassem matérias diferentes.

        E no caso de Levine e Malcolm, a diferença na abordagem da ciência apareceu logo no começo, quando estavam emSanta Fé. Os dois estavam interessados na extinção, mas Malcolm abordava a matéria de um modo geral, de um ponto de vista matemático. Seu distanciamento, suas fórmulas inexoráveis haviam fascinado Levine, e os dois homens iniciaram um intercâmbio informal em almoços freqüentes. Levine ensinava paleontologia para Malcolm e Malcolm ensinava matemática molecular para Levine. Começaram a esboçar algumas conclusões que os entusiasmaram. Mas começaram também a discordar. Mais de uma vez pediram a eles que saíssem do restaurante. Então saíam para o calor da rua Guadelupe e caminhavam para o rio, discutindo aos gritos, fazendo os turistas, assustados, passarem para a outra calçada.

        No fim, suas diferenças eram de personalidade. Malcolm achava Levine pedante e minucioso demais, preocupado com detalhes sem importância. Levine jamais via o quadro geral. Nunca dava atenção às conseqüências das suas ações. Levine, por seu lado, não hesitava em chamar Malcolm de imperioso e desligado, indiferente aos detalhes.

        — Deus está nos detalhes — Levine lembrou certa vez.

        — Talvez o seu Deus — respondeu Malcolm. — Não o meu. O meu está no processo.

       

        No seu posto de observação, Levine pensou que respostas eram exatamente o que se podia esperar de um matemático. Para ele os detalhes eram tudo, pelo menos em biologia, e, na sua opinião, a falha mais comum dos seus colegas biólogos era a falta de atenção aos detalhes.

        Levine vivia para os detalhes e não podia passar sem eles. Como o caso do animal que o havia atacado e a Diego. Levine pensava freqüentemente nele, lembrando tudo o que havia acontecido. Porque alguma coisa o intrigava, uma impressão que não conseguia definir.

        O animal atacou rapidamente e ele teve a impressão de ser uma forma básica de terópodos — pernas traseiras, cauda rígida, cabeça grande, o de sempre — mas no breve instante em que chegou a ver a criatura, parecia haver algo diferente ao redor das órbitas que o fazia pensar no Carnotaurus sastrei. Da formação Gorro Frigo, na Argentina. Além disso, a pele era muito estranha. Parecia de um verde mosqueado, mas havia algo que...

        Levine deu de ombros. A idéia estava no fundo de sua mente, mas não conseguia decifrá-la. Simplesmente não conseguia.

       

        Com relutância, Levine voltou a observar o bando de parassauros, ao lado do rio, perto dos apatossauros. De onde estava, ouvia os barridos típicos dos parassauros. Notou que a maioria deles emitia um som de curta duração, uma espécie de grasnado rouco. Às vezes vários animais faziam o som ao mesmo tempo, ou quase se sobrepondo um ao outro, de modo que isso parecia ter por fim indicar ao bando onde estava cada um. Havia também um barrido mais longo, mais dramático e menos freqüente, só emitido pelos animais maiores, que erguiam as cabeças e soltavam o urro alto e longo. Mas o que significa esse som?

        De pé, ao sol, Levine resolveu fazer uma pequena experiência. Com as mãos em concha nos lados da boca, imitou o grito do parassauro. Não foi uma imitação muito boa, mas imediatamente o parassauro que parecia ser o líder do bando ergueu a cabeça e olhou para um e para outro lado. Então respondeu com um grito baixo.

        Levine chamou outra vez.

        O parassauro tornou a responder.

        Levine ficou feliz e anotou o fato no caderno. Mas quando olhou outra vez, viu com surpresa que o bando todo se afastou dos apatossauros, formou uma fila indiana e começou a andar diretamente para o abrigo onde ele estava.

        Levine começou a suar.

        O que tinha feito? Uma idéia maluca passou por sua cabeça. Teria imitado o chamado para o acasalamento? Era só o que faltava, ser atacado por um dinossauro no cio. Quem poderia saber como aqueles animais se comportavam nessas horas? Com ansiedade crescente, ele os viu prosseguir na marcha. Talvez fosse bom chamar Malcolm e pedir conselho. Mas compreendeu que, ao imitar o grito do parassauro, ele tinha interferido no meio ambiente, introduzindo uma nova variante. Tinha feito exatamente o que dissera a Thorne que não pretendia fazer. Um ato impensado, sem dúvida. E certamente não muito importante na ordem das coisas. Mas Malcolm na certa ia ficar furioso com ele.

        Levine abaixou o binóculo e continuou a olhar. Um barrido profundo ecoou no ar, tão alto que feriu seus tímpanos. O chão começou a tremer e o abrigo no alto do andaime balançou perigosamente.

        Meu Deus, pensou ele. Estão vindo direto para mim. Levine se abaixou e procurou o rádio na mochila que estava no chão.

       

       PROBLEMAS DA EVOLUÇÃO

        No trailer, Thorne tirou a comida reidratada do microondas e distribuiu os pratos em volta da pequena mesa. Todos começaram a comer. Malcolm espetou a comida com o garfo.

        — O que é esta coisa? — ele perguntou.

        — Peito de frango cozido com ervas — disse Thorne. Malcolm experimentou e balançou a cabeça.

        —  A tecnologia não é maravilhosa? Consegue imitar exatamente o gosto do papelão.

        Malcolm olhou para os meninos que comiam com apetite. Kelly apontou com o garfo para os livros presos na estante ao lado da mesa.

        — Tem uma coisa que eu não entendo — ela disse.

        — Só uma? — disse Malcolm.

        —  Todo esse negócio sobre evolução. Darwin escreveu seu livro há muito tempo, certo?

        — Darwin publicou A origem das espécies em 1859 — disse Malcolm.

        — E até hoje todo o mundo acredita na sua teoria, certo?

        — Acho que seria mais justo dizer que todos os cientistas do mundo concordam com a idéia de que a evolução é o futuro da vida na Terra — disse Malcolm. — Eque descendemos de antepassados animais. Sim.

        — Tudo bem — disse Kelly. — Então, por que todo esse auê agora?

        — Todo esse auê — Malcolm sorriu — é porque todos concordam com o fato da evolução mas ninguém sabe como ela ocorre.

        A teoria tem grandes problemas. E é cada vez maior o número de cientistas que admite isso. ..

       

        Malcolm empurrou o prato.

        — Temos de seguir o caminho da teoria até uns duzentos anos atrás. Começando com o barão Georges Cuvier, o mais famoso anatomista na sua época, que vivia no centro intelectual do mundo, Paris. Por volta de 1800, ossos antigos começaram a ser desenterrados e Cuvier compreendeu que pertenciam a animais que já não existiam na Terra. Isso era um problema porque em 1800 a crença geral era que todas as espécies animais criadas viviam ainda. A idéia parecia lógica porque naquele tempo acreditavam também que a idade da Terra era de apenas alguns milhares de anos. E porque Deus, que havia criado todos os animais, jamais permitiria que suas criaturas fossem extintas. Assim, a extinção era impossível. Cuvier estudou a fundo os ossos encontrados e concluiu que, com Deus ou sem Ele, muitos animais estavam extintos — como resultado, pensava ele, de catástrofes mundiais, como o dilúvio de Noé.

        — Tudo bem...

        — Então Cuvier, embora com relutância, teve de acreditar na extinção — continuou Malcolm —, mas jamais aceitou a evolução. Para Cuvier, a evolução não podia acontecer. Alguns animais morriam e alguns sobreviviam, mas nenhum evoluía. Na sua opinião, os animais não mudavam. Então surgiu Darwin dizendo que os animais evoluem e que os ossos encontrados eram na verdade dos antepassados extintos dos animais vivos. As implicações da teoria de Darwin desagradaram a muita gente. Não queriam admitir a mudança na criação de Deus e não gostavam da idéia de ter macacos nas suas árvores genealógicas. Além de embaraçoso, era um insulto. O debate foi acalorado. Mas Darwin apresentou uma quantidade enorme de dados reais — ele tinha um caso arrasador. Assim, gradualmente, sua idéia da evolução começou a ser aceita pelos cientistas e pelo mundo em geral. Mas permanecia a questão: Como ocorre a evolução? Para isso Darwin não tinha uma boa resposta.

        — Seleção natural — disse Arby.

        —  Sim, essa foi a explicação dada por Darwin. O meio ambiente exerce uma pressão que favorece alguns animais que se reproduzem com maior freqüência em gerações sucessivas e é assim que ocorre a evolução. Porém, como muitas pessoas concluíram, a seleção natural não é na verdade uma explicação. É uma definição. Se um animal é favorecido, ele foi escolhido para isso. Mas o que é favorecido no animal? E como a seleção natural funciona realmente? Darwin não tinha idéia. E ninguém tentou dar uma resposta durante outros cinqüenta anos.

        — Mas são os genes — disse Kelly.

        — Tudo bem — concordou Malcolm. — Ótimo. Chegamos ao século XX. O trabalho de Mendel com as plantas é redescoberto. Fischer e Wright estudam as populações. Logo ficamos sabendo que os genes controlam a hereditariedade — seja lá o que for um gene. Não esqueçam que na primeira metade do século, durante todo o tempo da Primeira e da Segunda Guerras Mundiais, ninguém tinha idéia do que era um gene. Depois de Watson e Crick, em 1953, ficamos sabendo que os genes são núcleotídeos dispostos numa dupla hélice. Ótimo. E ficamos sabendo também sobre mutação. Assim, na segunda metade do século XX, temos uma teoria da seleção natural segundo a qual as mutações surgem espontaneamente nos genes, que o meio ambiente favorece as mutações que são benéficas e que desse processo de seleção ocorre a evolução. É simples e direto. Sem interferência de Deus. Nenhum princípio organizador mais alto está envolvido. No fim, a evolução é somente o resultado de um conjunto de mutações que sobrevivem ou morrem. Certo?

        — Certo — disse Arby.

        — Porém, essa idéia apresenta problemas — prosseguiu Malcolm. — O primeiro é um problema de tempo. Uma única bactéria — a mais antiga forma de vida — tem duas mil enzimas. Os cientistas fizeram a estimativa do tempo necessário para a união aleatória dessas enzimas a fim de formar a sopa primordial. Essas estimativas vão de quarenta a cem bilhões de anos, mas a Terra tem só quatro bilhões de anos. Desse modo, só o acaso parece um processo lento demais. Especialmente considerando que as bactérias só apareceram quatrocentos milhões de anos depois do começo da Terra. A vida apareceu rapidamente — por isso alguns cientistas concluíram que a vida na Terra é de origem extraterrestre. Na minha opinião, isso é fugir ao problema.

        — Muito bem...

        — O segundo problema é o da coordenação. Se acreditarmos na teoria atual, então toda a complexidade maravilhosa da vida não passa de acúmulo de eventos casuais — um conjunto de acidentes genéticos unidos. Porém, quando se estudam de perto os animais, vemos que vários elementos parecem ter evoluído simultaneamente. Os morcegos, por exemplo, que possuem um sentido de ecolocalização, orientam-se pelo som. Para chegar a isso, várias coisas precisam evoluir. Os morcegos devem ter um aparelho especializado para produzir sons, devem ter ouvidos para ouvir ecos, devem ter cérebros especializados para interpretar os sons e corpos especializados para mergulhar no ar e caçar insetos. Se todas essas coisas não evoluírem simultaneamente, não haverá nenhuma vantagem. E imaginar que tudo isso acontece simplesmente por acaso é como pensar que um tornado pode atingir um depósito de ferro-velho e montar um avião 747 em perfeito estado de funcionamento. É difícil acreditar nisso.

        — Muito bem — disse Thorne. — Eu concordo.

        — Vamos ao problema seguinte. A evolução nem sempre age como uma força cega. Certos nichos do meio ambiente não são preenchidos. Certas plantas não são usadas como alimento. E certos animais não evoluem muito. Os tubarões não mudam há cento e sessenta milhões de anos. Os marsupiais não mudaram desde a extinção dos dinossauros, há sessenta e cinco milhões de anos. Os ambientes dos animais mudaram espetacularmente, mas os animais permanecem quase os mesmos. Não exatamente os mesmos, mas quase. Em outras palavras, é como se não tivessem respondido ao meio ambiente.

        — Talvez já estivessem bem-adaptados — disse Arby.

        — Pode ser, ou talvez seja alguma coisa que não sabemos.

        — O quê, por exemplo?

        — Certas regras que influenciam no resultado.

        —  Está dizendo que a evolução é dirigida? — perguntou Thorne.

        — Não. Isso é criacionismo e é errado. Simplesmente errado. Estou dizendo que a ação da seleção natural sobre os genes talvez não seja toda a história. E simples demais. Outras forças estão também em funcionamento. A molécula de hemoglobina é uma proteína dobrada como um sanduíche em volta de um átomo central de ferro que aglutina o oxigênio. A hemoglobina se expande e se contrai quando recebe e fornece oxigênio — como um minúsculo pulmão molecular. Ora, conhecemos a seqüência de aminoácidos que formam a hemoglobina. Mas não sabemos como dobrá-la. Felizmente não precisamos saber porque, se fizermos uma molécula, ela se dobra sozinha. Ela se organiza. E essa parece ser uma das muitas provas de que todas as coisas vivas têm a propriedade de auto-organização. As proteínas se dobram. As enzimas interagem. As células se dispõem para formar os órgãos, os órgãos se dispõem para formar um indivíduo coerente. E as populações se organizam para formar uma biosfera coerente. Partindo da teoria da complexidade, começamos a perceber como pode acontecer essa auto-organização e o seu significado. E ela sugere uma mudança importante no modo como vemos a evolução.

        — Mas — disse Arby —, no fim, a evolução pode continuar a ser o resultado da ação do meio ambiente sobre os genes.

        — Não acho que seja suficiente, Arb — disse Malcolm. — Acho que há mais coisas envolvidas. — Acho que tem de haver mais, até para explicar como surgiu a nossa espécie.

       

        - Há cerca de três milhões de anos — continuou Malcolm —, alguns macacos africanos que viviam nas árvores desceram para o chão. Não havia nada de especial nesses macacos. Seus cérebros eram pequenos, e eles não eram especialmente inteligentes. Não tinham garras nem dentes afiados como armas. Não eram especialmente fortes ou rápidos. Certamente não estavam preparados para enfrentar um leopardo. Mas, como eram pequenos, começaram a andar de pé para poder ver acima da alta relva africana. Foi assim que começou. Apenas macacos comuns, olhando por cima da relva.

        — Com o passar do tempo, os macacos passaram a ficar de pé durante mais tempo. Isso deixava suas mãos livres para fazer qualquer coisa. Como todos os macacos, eles usavam ferramentas.

          Os chimpanzés, por exemplo, usam gravetos para tirar cupins da terra. Esse tipo de coisa. Então, nossos ancestrais, os macacos,             desenvolveram ferramentas mais complexas. Isso estimulou o crescimento dos seus cérebros em tamanho e complexidade. Começou uma espiral. Ferramentas mais complexas levavam a um cérebro mais complexo, que levava a ferramentas mais complexas.

          E nossos cérebros literalmente explodiram, em termos de evolução. Nossos cérebros dobraram de tamanho num período de mais  ou menos um milhão de anos. E isso nos causou problemas. — Que problemas?

        — Para começar, o problema de nascer. Cérebros grandes não  podem passar pelo canal vaginal, o que significa que a mãe e o filho morreriam de parto. Isso não é bom. Qual foi a resposta evolutiva?              Fazer com que os bebês humanos nascessem numa fase anterior do desenvolvimento, quando seus cérebros ainda podem passar pela   pélvis. E a solução marsupial — a maior parte do crescimento  ocorre fora do ventre materno. O cérebro de uma criança humana dobra de tamanho no seu primeiro ano de vida. É uma boa solução              para o problema do nascimento, mas cria outros problemas.                      Significa que as crianças humanas são dependentes e indefesas durante muito tempo após o nascimento. Os filhotes da maioria dos mamíferos andam alguns minutos depois de nascer. Outros dentro de alguns dias ou semanas. Mas os humanos só andam depois de um ano. Não podem se alimentar sozinhos durante mais tempo ainda. Assim, um dos preços do cérebro maior foi que nossos antepassados tiveram de desenvolver uma organização social nova               e estável que permitisse cuidar das crianças durante muitos anos.

        Essas crianças com cérebros grandes, completamente indefesas,              mudaram a sociedade. Mas essa não é a conseqüência mais             importante.

        — Não?

        — Não. Nascer num estado de imaturidade significa que os bebês humanos não têm os cérebros completamente formados. Eles não nascem com um comportamento instintivo inerente. O máximo que podem fazer instintivamente é sugar e agarrar as coisas. O comportamento humano complexo não é instintivo. Assim, as sociedades humanas tiveram de criar a educação para preparar os cérebros dos filhos, para ensiná-los a agir. Toda sociedade humana despende um grande tempo e grande quantidade de energia para ensinar às crianças o comportamento adequado. Se olharmos para uma sociedade mais simples, em algum lugar da floresta tropical, veremos que cada criança nasce numa rede de adultos responsáveis por sua educação. Não apenas os pais, mas tias e tios, avós e os anciãos da tribo. Uns ensinam a criança a caçar, apanhar alimento ou tecer, outros ensinam tudo sobre sexo ou guerra. Mas as responsabilidades são claramente definidas, e, se uma criança não tiver, digamos, uma irmã do irmão da mãe para uma instrução específica, o povo se reúne para apontar um substituto. Isso porque, em certo sentido, criar as crianças é a razão pela qual a sociedade existe. E a coisa mais importante que acontece e a culminação de todos os instrumentos, linguagem e estrutura social criados pela sociedade. E finalmente, milhões de anos depois, temos crianças usando computadores.

        — Muito bem, se esse quadro tem sentido, onde atua a seleção fnatural? Atua no corpo, aumentando o cérebro? Atua na seqüência do desenvolvimento, fazendo as crianças nascerem mais cedo? Age sobre o comportamento social, criando a cooperação no cuidado da criança? Ou age em toda a parte ao mesmo tempo — nossos corpos, nosso desenvolvimento e nosso comportamento social?

        — Em toda a parte ao mesmo tempo — disse Arby.

        — E o que eu penso — concordou Malcolm. — Mas deve haver também partes dessa história que acontecem automaticamente, como resultado da auto-organizaçáo. Por exemplo, os bebês de todas as espécies têm uma aparência característica. Olhos grandes, rosto pequeno, movimentos não-coordenados. Isso se aplica aos bebês humanos, aos filhotes de cães e de aves. E parece provocar nos adultos um sentimento de ternura para com eles. De certo modo, podemos dizer que a aparência de um bebê auto-organiza o comportamento do adulto. E no nosso caso isso é muito bom.

        — O que isso tem a ver com a extinção dos dinossauros? — perguntou Thorne.

        — Os princípios da auto-organização podem agir para melhorar ou piorar. Assim como a auto-organização pode coordenar a mudança, pode também levar uma população ao declínio e fazer com que ela perca a força. Nesta ilha, tenho esperança de ver adaptações auto-organizadas no comportamento de verdadeiros , dinossauros — e isso nos dirá por que foram extintos. Na verdade, tenho certeza de que já sei por que os dinossauros foram extintos.|

        Ouviram a voz de Levine no rádio.

        — Bravo. Eu mesmo não diria melhor. Mas talvez fosse bom você ver o que está acontecendo aqui. Os parassauros estão fazendo uma coisa muito interessante, Ian.   

          — Que coisa?

         — Venha ver.

        — Meninos — disse Malcolm —, vocês ficam aqui cuidando dos monitores. —Apertou o botão transmissor do rádio. — Richard? Estamos indo.

       

       OS PARASSAUROS

        Richard Levine, tenso, segurou com força o parapeito do alto do abrigo, observando os animais. Bem à sua frente, a cabeça magnífica de um parassauro apareceu sobre uma pequena elevação. A cabeça em forma de bico-de-pato do hadrossauro tinha um metro de comprimento mas parecia maior por causa da crista óssea inclinada para trás.

        Quando o animal chegou mais perto, Levine viu o mosqueado verde na cabeça. Viu o pescoço longo e poderoso, o corpo pesado com a barriga verde-clara. O parassauro tinha três metros de altura e o tamanho aproximado de um elefante. A cabeça era quase da altura do assoalho do abrigo onde ele estava. O animal se movia determinadamente para ele, os pés batendo com força no chão. Um pouco depois uma segunda cabeça apareceu — uma terceira e uma quarta. Os animais, soltando seu barrido, caminhavam em fila indiana na direção dele.